KEGG   Chrysemys picta (western painted turtle): 101952105Help
Entry
101952105         CDS       T04662                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00052  Galactose metabolism
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101952105 (GANC)
   00500 Starch and sucrose metabolism
    101952105 (GANC)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101952105 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 101952105
NCBI-ProteinID: XP_008168116
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MEPAKEEESSVQDEAVDKSNFKNCNHIAFYRRQKLLHPGKSLYQALLDSVTLCNDSVKLQ
IINEKNKVPLLVEIYAIEGNIFRLKINEVSPLKSRYEVPDVLIKEPTTQRLSIAQKEAGI
LVLTCASEDRKLHITANPFQIELESKGETVLSVNTNGLLYFEHLQPPPQNSKTTAQKKED
TSIGSSQENQEDLGLWQEEFGSFLDIKANGPSSIGLDFSLHGCEHVYGIPEHAETLLLKN
TSDDDAYRLFNLDVYGHKIHDKMGIYGSVPFLLAHKPNRTSGIFWLNSSETLVEINTKAV
MEHVPSRSPPDITKQRVVPQTDVRWMSESGIIDVFLLMGPNPFDIFKQYAQLTGTQALPP
LFSLGYHQCRWNYEDEQDVKTVDAGFDEHDIPYDVIWLDIEHTEGKRYFTWDKKKFQHPK
RMQELLTRKKRKLVVIIDPHIKVDPMYTLYSQAKKKGYFVKNRTGQDFEGICWPGSSSYL
DFTNPDVREWYADQFAFKSYKGSTDILFVWNDMNEPSVFKAAELTMQRDAVHHGNWEHRE
VHNLYGFYQQMATAEGLIKRSGGQKRPFVLTRSFFAGSQKYGAVWTGDNVAEWSYLKISI
PMLLTISIAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHANIESKRREPWLFG
DENTRIIREAIRERYTLLPYLYSLFYRAHTTAEPVMRPLWVEFPKEQETFGVEDEYMLGN
ALLVHPVIEQEATTVNVLLPGSDEVWYDFRRFRRLDYPGTLKIPVTLESIPVFQRGGGVV
PLKTTVGRSTEWMTDISYELRVALDSKDFAVGELYLDDGHSFQYLHKKQFLHRKFTFHKN
VFSSSCADEIGQYHTKCVVERVLILGVQKQPTSVTVSLHGKRDGKDKEVVFTYDAKSSML
TLEKLLLNVGADWEIHIK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagctaaggaagaagaaagcagtgttcaagatgaggctgtggacaaaagcaac
tttaagaactgcaaccacattgctttctacaggcgtcagaaacttctgcatcctgggaag
tccttgtatcaagcattgttggattcggttacattatgcaatgatagtgtcaaactccaa
ataattaatgagaagaataaggttcctctcctagtggaaatttatgcaatagaaggcaac
attttcaggcttaaaattaatgaggtatctcctctcaaatcaaggtatgaagtccctgat
gttctcataaaagaacctaccactcagaggctctctatagcccagaaggaggcaggtatt
ctggtactgacatgtgccagtgaggaccgcaagcttcatatcacagcaaatccattccag
atagaactagagtccaagggtgagaccgtactgagcgtgaacaccaatggcctgttgtac
tttgagcatctacaaccgccaccccaaaacagcaaaactacagcacaaaagaaagaggac
acatcaattggctcctctcaggaaaatcaagaggatctgggtctctggcaggaggaattt
ggcagttttttagacatcaaagctaatggtcccagttccataggcttggatttttctttg
catggatgtgaacatgtctatggaataccagagcatgcagaaacacttctcctcaaaaac
accagtgacgatgatgcctaccggctttttaacttggatgtctatgggcacaagattcat
gacaaaatgggcatttatggttcagtgccctttctgttagcacataaacctaacagaact
tctgggatcttctggctgaattcctcagaaactctagtggagattaatacaaaagctgta
atggagcatgtaccatccagatctcctccagacataactaagcagagagtggtgcctcaa
actgatgtgcgctggatgtcagaaagtggaataattgatgttttcctcctaatgggaccc
aacccttttgatatcttcaagcaatatgcacaattgacaggcactcaagccctgcctcca
ctcttctccttgggctaccaccaatgccgctggaactatgaggatgagcaggatgtaaag
accgtagacgctggctttgatgagcatgacatcccctatgatgttatatggctggacata
gagcacacagaaggcaagaggtacttcacctgggacaagaaaaaatttcagcaccccaaa
aggatgcaggaactgctcacaaggaaaaaacgcaagcttgttgtcattatagatcctcac
attaaggttgatcccatgtacaccctatactctcaggccaaaaagaaggggtattttgtg
aaaaataggacaggccaagactttgagggcatctgttggccaggttcctcttcttacctg
gattttaccaatcctgacgtccgagaatggtatgcagatcagtttgccttcaaatcatat
aagggctctactgacatcctgtttgtatggaatgatatgaatgagccttcagtcttcaaa
gcagcagaactaaccatgcagagagatgctgtccatcatggcaactgggagcaccgggag
gttcacaatctctatggcttttaccagcaaatggcaactgcagaaggacttatcaaacgc
tctgggggacagaagaggccatttgtcctcacgcgatctttctttgccggatcacagaag
tatggtgcagtatggacaggagacaacgtagcagagtggagttacttaaaaatctccatt
ccaatgttgctcacaatcagtattgcaggaatttcattctgtggagctgatgtgggcggg
tttattggggacccagaaccagagctacttgttcgctggtatcaggctggtgcgtaccaa
ccatttttcagaggccatgccaatatcgaaagcaaacggcgtgaaccatggctatttggg
gatgagaacacacggatcatcagggaagccattagagagcgctacacccttctgccctac
ttgtattcactgttctaccgggcacacaccactgctgaaccagtcatgaggcctctctgg
gtagagttccccaaggaacaagaaacttttggtgtggaagatgaatacatgctgggaaac
gctttactggtgcatccagtcattgaacaagaggccactacagtgaacgttttactgcct
gggtcagatgaggtttggtatgacttcagaagatttagacgactggactatccaggaact
ctgaagatcccagtaacactggagagtattccagtgttccagcgaggtgggggtgtggtg
ccccttaagaccaccgtaggaagatccactgaatggatgacagatatttcttacgaactc
cgtgttgctctggactccaaggactttgcagtaggtgagctctatctagatgatgggcat
tcatttcagtacctccataagaagcaattcctgcacaggaaatttactttccacaagaat
gttttctcttccagctgtgctgatgaaattgggcagtaccacacaaaatgtgtagttgaa
cgggtactaattctgggagttcaaaagcaacccacatctgtgacagtcagtctccatggt
aagagagatgggaaagacaaagaagtggttttcacatatgatgccaagtcctccatgttg
accctggaaaaactattattaaatgttggtgctgactgggaaattcacatcaagtga

DBGET integrated database retrieval system