KEGG   Chrysemys picta (western painted turtle): 101952242Help
Entry
101952242         CDS       T04662                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00053  Ascorbate and aldarate metabolism
cpic00071  Fatty acid degradation
cpic00280  Valine, leucine and isoleucine degradation
cpic00310  Lysine degradation
cpic00330  Arginine and proline metabolism
cpic00340  Histidine metabolism
cpic00380  Tryptophan metabolism
cpic00410  beta-Alanine metabolism
cpic00561  Glycerolipid metabolism
cpic00620  Pyruvate metabolism
cpic01100  Metabolic pathways
Module
cpic_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101952242 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101952242 (ALDH2)
   00620 Pyruvate metabolism
    101952242 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101952242 (ALDH2)
   00561 Glycerolipid metabolism
    101952242 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101952242 (ALDH2)
   00310 Lysine degradation
    101952242 (ALDH2)
   00330 Arginine and proline metabolism
    101952242 (ALDH2)
   00340 Histidine metabolism
    101952242 (ALDH2)
   00380 Tryptophan metabolism
    101952242 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101952242 (ALDH2)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101952242 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101952242
NCBI-ProteinID: XP_005298651
LinkDB All DBs
Position
Un
AA seq 532 aa AA seqDB search
MALRLPSARMLRAAALGSRLWGRAAPAQLASPFSAAAPAIPAPNPRPEIAYNKIFINNEW
HDAVSKKTFPSVNPATGEVICQVAEGDKADVDKAVQAAKAAFQLGSPWRRMDASHRGKLL
YRLADLIERDRAYLAELETLDNGKPYSIAYLVDLDMVTKCIRYYAGWADKCHGKTIPLDG
DFFSYTRHEPVGVCGQIIPWNFPLLMQAWKIGPALATGNVVVMKVAEQTPLTALYVASLI
KEAGFPPGVVNIVPGYGPTAGAAIASHMEVDKVAFTGSTEVGHLIQKAAAESNLKRVTLE
LGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDVYHEFVERSIERAKS
RVVGNPFDSQTEQGPQVDEEQFKKILGYISTGKQEGAKLLCGGNPAADRGYFIQPTIFGD
VQDNMTIAIEEIFGPVMQLLKFKTIEEVIERANNSKYGLAAAVFTKDLDKANYVSQALRA
GTVWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKNS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcgtctccccagtgccaggatgctgcgtgcggccgcgctgggctcccggctg
tggggccgggcggctccggcccagctcgccagccccttctcggccgcggcccccgccatc
cccgccccgaacccccgcccggagatcgcctacaacaagattttcataaacaatgaatgg
catgatgcagtcagcaagaaaaccttcccttccgtcaacccagcaacgggggaagttatc
tgccaggttgctgagggagacaaggcggatgtggacaaggccgtgcaggcggccaaggca
gccttccagctgggctcgccttggagacggatggacgcctctcaccgggggaagctgctg
taccgcctcgctgacctgattgagagagatcgggcttacctggccgagctggaaactctg
gataatggcaaaccgtactccatcgcctacttagtggatctggacatggtaaccaaatgt
atcaggtactacgctggctgggctgacaaatgtcatggaaaaaccattcccctagatgga
gacttcttcagttacacaagacatgagccagtaggggtctgtggacagatcatcccgtgg
aatttcccacttctgatgcaggcgtggaaaatcgggcccgccttggccactgggaatgtg
gttgtgatgaaagtggctgagcaaacacccctgacagctctttatgtggccagtctgatc
aaagaggctggattcccaccaggggtggttaatattgttcccggctatgggcccactgca
ggggctgccattgcctcccacatggaagtagataaagtggccttcactggctccactgag
gttgggcatctgatccagaaggctgcagcagagagtaacctgaagagagtgacgctggag
cttggcgggaagagcccaaatatcatcatgtctgatgctgacatggactgggctgttgag
caagcccactttgccctattcttcaaccaaggccagtgctgctgtgctggatcccggacg
tatgtccaagaagatgtatatcatgagttcgtagagagaagcattgagagagccaagtcc
agggtggttggaaacccgtttgactctcaaactgaacagggacctcaggtagatgaagag
cagtttaagaagatccttggctacatcagcactgggaagcaggaaggagccaaactgctt
tgtggtggcaatcctgctgcagacaggggctatttcatccagccgactatctttggagat
gtgcaggacaacatgaccattgctatagaggagatatttgggccagttatgcagctcttg
aagttcaaaaccattgaggaagtcattgagagagcaaataactccaagtatggtctggca
gcagcagtcttcacgaaagatcttgacaaagcaaactacgtgtcccaggcattgcgggct
ggaactgtctggataaactgttatgatgtgtttggagctcaggccccatttggtgggtac
aaagcatctggaaatgggcgagagttgggggaatatggcctggaggcatatacagaagtg
aaaactgtaacaataaaagttccacagaagaactcttaa

DBGET integrated database retrieval system