KEGG   Chrysemys picta (western painted turtle): 101952779
Entry
101952779         CDS       T04662                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101952779 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101952779 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cpic04052]
    101952779 (KITLG)
Cytokines and growth factors [BR:cpic04052]
 Growth factors
  Growth factors (RTK binding)
   101952779 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 101952779
NCBI-ProteinID: XP_005279182
LinkDB
Position
1
AA seq 278 aa
MKKTQTWIITCFYLQLLLLNPLVKALISCGNPVTDDVNDITKLVGNLPNDYMITLRYVQK
MDTLPNHCWLHLMVPEFSKSLHNLLQKFSDMSDVLSNYSIINNLTRIINDIMLCLDSEKN
KNFRKENVHLYEEGRFIPEEFFRRFNRTIDAYTDFAKKSDHSDCVLPSTTETPENNPRVS
VTNPLLLPPVAASSLKNDSSDSNKEALDFISSPSLKVISIALPSLFSLLIGFTLGAICWK
KTHRTPRPESDETTQCNNCQEDNEISMLQQKEKELLQV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcttttatcttcaactgctcctacttaat
cctcttgtcaaagccctaatatcctgtgggaatccagtgacagatgatgtgaatgacatt
acaaaactggttggaaatcttccaaatgattatatgataacccttaggtatgttcagaag
atggacactctgcctaatcactgttggttgcatttgatggtgcctgagttttcaaagagt
ctgcataatcttctgcaaaaattttcagatatgtctgatgttttaagtaactattcaatc
atcaataatctcacgaggataatcaatgatattatgttatgtctagattctgagaaaaat
aagaattttagaaaagaaaatgttcatctttatgaagaaggcaggttcattcctgaagaa
ttctttaggcgctttaatagaaccattgacgcctacacggattttgcaaaaaaatcagat
catagtgactgtgttctgccatcaacaacagaaacaccagagaacaatccaagagtcagt
gtaacaaatccattgttgttacctcctgttgctgccagttcccttaagaatgacagcagt
gacagtaacaaagaagcactcgacttcattagcagccccagcctgaaagtgataagcata
gcactgccgtcattgttttctcttcttattggctttactttgggagccatctgctggaag
aaaacacatcgcacacccagaccagaaagtgatgaaacaacacagtgtaataactgtcaa
gaggataatgagataagtatgttgcagcaaaaagaaaaagagctcttacaagtgtag

DBGET integrated database retrieval system