KEGG   Chrysemys picta (western painted turtle): 101953088Help
Entry
101953088         CDS       T04662                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101953088 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cpic03012]
    101953088 (EIF3A)
Translation factors [BR:cpic03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    101953088 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 101953088
NCBI-ProteinID: XP_008164528
LinkDB All DBs
Position
6
AA seq 1396 aa AA seqDB search
MPVYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLSNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRISLINDMVRFNVVQHVVPEVKELYNWLEVDFHPLKLCDRVTKVLNWVRDQVEK
EPELQLYVPHLQNNTILRLLQQVAQIYQTIDFSRLTTLVPFVDAFQLERAIVDAARHCDL
QVRLDHTSRTLSFGSDLNYSTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALEVIKPP
NIVQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQXEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKTAYEEQRIR
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDKDLFVSRLKAARQSIYQEKLKQFE
ERLAEERHNRLEERKRQRKEERRVSYYREKEEEEQRLQEEKMLKELEEKERVEREKREQE
QREYQERVRKLEEVERKKRQREQEIEERERRREEERRGLDDPLSRRESRWGDRDADNTWR
RTAEPESEWRRAPPEREWRRGEGRDDERPFRRGDDLLRRGGAEEKEPSSREANEDRAPKQ
DVEEDGEPRRGMDEDGEPRRDEDREPRRDEDGEPKRDEDVEPRRGMDEDGGPRRGVDQDR
GSWRTADDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGPRRGLDDDRGNWRTADEDR
GPRRGLDEDRGPRRGLDEDRGSWRTADDDRGPRRGLDDDRGPRRGLDDDRISRRDEDRGP
WRSADEDRLSRRDEDRGPWRGGDDDRGPRRGDDSRPGPWRPFGKPGGWREREKAREDSWG
PPRDSRPSEDRELDRDKDIDENEKDREFDKDRDLDRDDRFRRPRDEAGWRRGPAEEVSSW
RDSGRRDEWDRGGRDMRDDRGGRDLRDRRADDRDRRGPPIRTDREETSSWRRGDDRKEER
GEERETIRRAAPAPALAPAPAPTPVPAAAPAAPPISKDRERDAESEKGSWRTEKERESLR
RTKNETDEDGWTTVRR
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtatttccagcggcccgagaatgccctgaagcgggcgaacgaatttcttgag
gttggcaagaaacaacctgcccttgatgttctttatgatgttatgaaaagcaaaaaacat
cgaacatggcaaaaaatccacgagccgattatgctgaagtatctggagctctgcgtggac
ctccgcaagagccacctggcaaaggaaggattgtatcagtacaagaatatttgccagcag
gtgaacatcaaatccttggaggatgttgttcgagcctatttgaaactagctgaagaaaaa
acggaagctgccaaggaagagtcccagcagatggtgctagatatagaagacttggataat
attcaaactccagagagtgttctcttaagtgctgtaagtggggaagacactcaagatcgt
acagatcggttgcttttgactccctgggttaaatttctatgggaatcatacagacagtgt
ttggaccttcttcgaaacaattctagagtggaacgcctctaccatgatattgcacagcaa
gcttttaagttctgcttgcagtacactcgtaaggctgagttccgtaaactctgcgataac
ctgaggatgcatttagggcagatccaacgccaccataaccaaagtacagcaattaacctc
agtaatcctgagagccagtctatgcacttggagacaaggcttgtacagctggacagtgct
attagcatggaattgtggcaggaagctttcaaagcagtggaggatattcatgggctattc
tccttgtctaagaaaccacccaagccccagctgatggcaaattactatcacaaagtttcc
actgtcttctggaaatcaggaaatgctcttttccatgcatccacacttcaccgactgtat
cacctgtcaagagaaatgcgaaagaatctcacacaagaggagatgcagaggatgtcaacc
cgagtccttttggctactttgtcaattcctataactcctgagcgaactgatattgctcgt
cttctggatatggatggtatcatcgttgaaaagcagcgacgtctggccacgctgctgggc
ctccaggccccacctacacgcatcagtcttattaatgacatggtgaggttcaatgtagtg
cagcatgttgttccggaggtgaaggaactttacaattggcttgaagtagatttccaccca
ctaaagctatgtgatcgtgtaaccaaggttctaaactgggtgagagatcaagttgaaaag
gaacctgaattgcagctgtatgtcccacatctgcaaaacaacaccatccttcgtcttctg
cagcaggtggcgcagatttatcagaccatcgacttttctcgtttaactaccttggttcct
tttgttgatgctttccaattagaacgtgctattgtcgatgcagccagacattgtgacttg
caagttcgccttgatcatacgtctcgaacgctgagttttggatcagatttaaattattca
actcgggaagatgccccgcttggccctcagctgcaaagtatgccttctgagcaaattaga
aatcagctgactgctatgtcctctgctctcgctaaggctcttgaagtcattaaaccgcca
aacatagtgcaagagaaggaagaacaacatcagttagctgtcactgcttacttaaaaaat
tcaaggaaagagcatcagcgtatccttgctcgtcgtcaaactatagaggagagaaaggag
cgtcttgaaagtctaaacattcagcgtgagaaagaagagttggaacagcgtgaagctgaa
cttcaaaaagttcgtaaagctgaagaagagagactgcgccaggaggcaaaagagagagag
aaggagcgtattctgcaagaacatgagcaaatcaaaaagaaaactgttcgtgaacgcttg
gagcagattaagaagactgaactgggagccaaggcattcaaagatattgatattgaggat
cttgaagaattggaccctgacttcatcatggctaaacagnttgaacagctggagaaagaa
aagaaggaactccaagaacgtctgaagaatcaggaaaagaagattgactattttgaaaga
gcaaagcgcttggaagaaattcctctgataaagactgcctatgaagaacaaagaatccga
gatatggacctgtgggaacagcaagaagaagaaaggatcaccacaatgcagctggaacgc
gaaaaagccttggagcataagaacaggatgtcaaggatgttggaggataaagacttattt
gtatctaggctcaaggcagcacgacaatccatttatcaggaaaaactcaaacagtttgaa
gaaaggttagcagaagaaagacataatcgtttggaggaacgtaagagacaacgcaaagag
gagaggcgtgtttcttattacagagaaaaggaggaggaagagcagagattgcaagaagaa
aaaatgcttaaagagctcgaagagaaggaacgtgttgagcgtgaaaaacgtgagcaggaa
cagcgtgaataccaggagcgtgtcagaaaactagaagaagtagagaggaaaaaacgtcaa
agagagcaggaaattgaagagagggagcgtcgcagagaagaggagaggaggggtcttgat
gacccactttcaagaagggaatctcgttggggtgatagagatgctgacaacacctggaga
cgaacagctgagccagaatctgaatggagacgagcaccaccagagagggaatggcgccgt
ggagaagggcgtgatgatgaaagacctttccgaagaggagatgatctacttagacgtggt
ggtgctgaagagaaagagccttcttcccgggaagcaaatgaagaccgagcccccaagcag
gatgtggaagaggacggggaacccaggcggggcatggacgaggatggggaacccaggcgg
gacgaggatagggaacccaggcgggatgaggatggggaacccaagcgggatgaggacgtg
gaacccaggcggggcatggacgaggatgggggacctaggcggggcgtagatcaggacaga
gggagttggcgcactgcagatgacgacagggggcccaggcgtggcctggatgacgacagg
gggcccaggcgtggcctggatgacgacagggggcccaggcgtggcctggatgacgacagg
gggcccaggcgtggcctggatgacgacagggggaattggcgcactgcagatgaggatagg
ggtcccaggcgcgggctggatgaggataggggtcccaggcgcgggctggatgaggatagg
gggagttggcgcactgcagatgatgacaggggacctaggcgtggtctggatgacgacagg
ggacctaggcggggtctggatgatgacagaatttccagacgagatgaagacagaggcccc
tggcgtagtgcagatgaggatcgactctcaagacgtgatgaagacagaggtccatggcgt
ggtggggatgatgacagagggcccaggcgtggtgatgattcaagacctggtccttggaga
ccatttggtaaaccaggtggatggagagaacgagagaaagctcgtgaagacagctgggga
cccccgcgagactccagaccttcggaagaccgcgagttggatagagataaagatattgat
gaaaacgaaaaggatcgcgagtttgacaaagatcgtgaccttgatcgggatgatcgcttc
agacgtccaagggatgaggctggctggagaagaggaccagctgaggaagtttccagctgg
agagattcaggtcgtcgagacgaatgggatagaggtggtcgtgacatgagagatgaccgg
ggtggtcgtgacctgagagatcggcgtgctgatgatagagatagaagaggacctccaatc
agaacagaccgtgaagaaacgagttcatggcggcgtggtgacgacagaaaagaagaacgt
ggggaagagcgtgaaactatccggcgagctgctccggctccggctctggctccagctccg
gctcctactcctgttcctgctgctgctcccgctgctcctcctatttcaaaagatagggag
agggatgcagagagcgagaaggggtcctggagaacagaaaaagaacgagaatctcttcgt
cgcactaaaaatgaaacagatgaagatggatggaccactgtacgacgttaa

DBGET integrated database retrieval system