KEGG   Chrysemys picta (western painted turtle): 101953116Help
Entry
101953116         CDS       T04662                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00604  Glycosphingolipid biosynthesis - ganglio series
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    101953116 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cpic01003]
    101953116 (B3GALT4)
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     101953116 (B3GALT4)
Glycosyltransferases [BR:cpic01003]
 Glycan extension
  Glycolipid
   101953116 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 101953116
NCBI-ProteinID: XP_008175200
LinkDB All DBs
Position
Un
AA seq 350 aa AA seqDB search
MAPRLCPARRPSAWLLRGLLAGLGGLALVSLLVGGTGEELLSWSLAPFLGGGGGFLHADP
PLPGPDSFLLPNVDGCRPRAPFLLVLVASAPGHTAQRQAVRASWGGAHRAGGYPVRTLFA
LGAPGSGEEQARLEEESQQHGDLVQGRFADTYANLTLKTMMLLGWAAAHCPGAAFVVKVD
DDVFLNLPVLARHLGALPSPHRLYLGRVHWRVQPNRDPGNRHHVPASAYPAGAFPPYCSG
TAYVLSGDAALGVLGAAPHVPPVPLEDVYVGLCARWAGLAPTHTARMAGSTHYPMDLCCY
GEVLYSVHQVGPQAMASAWAMVGGEGGACTPLHRGLGVLRCKVLALLEGL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccccccggctctgccccgcccggcgcccctctgcctggctgctgcgggggctgctg
gcagggctgggggggctggcgcttgtgagcctcctggttgggggcacaggggaggagctg
ctatcgtggtcactggcccccttcctgggaggcgggggaggtttcctgcacgcagacccc
cccttgcctggccccgactccttcctgctgcccaacgtggacggctgcaggccccgggcc
cccttcctgctggtgctggtggccagcgcgccggggcacacggcccagcgccaggcggtg
cgtgccagctgggggggcgcccacagggccggggggtacccggtgcggacgctcttcgcc
ctgggggcaccgggctcaggcgaggagcaggcccggctggaggaagagtcccaacagcac
ggggacctggtccagggccgcttcgccgacacctacgccaacctgaccctcaagaccatg
atgctgctgggctgggcggccgcccactgccctggcgctgcctttgtggtgaaggtcgac
gacgacgtcttcctcaacctgcccgtcctggcccgccacctgggggcgctgcccagccct
caccggctctacctgggccgggtccactggcgggtgcagcccaaccgcgaccccggcaac
cggcaccacgtcccggcctccgcctacccggccggggccttccccccctactgcagcggc
acggcgtacgtgctgtccggcgacgctgccctgggggtgctgggggctgccccccacgtg
cctcccgtgcccctggaggatgtctacgtggggctgtgcgctcgctgggctggcttggcc
cccacccacacggcccgcatggctggatccacccactaccctatggacctctgctgctac
ggggaggtgctgtacagcgtgcaccaggtgggccctcaggcaatggcgtcagcctgggct
atggtggggggagaagggggagcctgtaccccactgcatagggggctgggggtgctgagg
tgcaaggtgctagccctgctggagggtctgtga

DBGET integrated database retrieval system