KEGG   Chrysemys picta (western painted turtle): 101953786
Entry
101953786         CDS       T04662                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04012  ErbB signaling pathway
cpic04068  FoxO signaling pathway
cpic04110  Cell cycle
cpic04115  p53 signaling pathway
cpic04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101953786
   04068 FoxO signaling pathway
    101953786
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101953786
   04115 p53 signaling pathway
    101953786
   04218 Cellular senescence
    101953786
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101953786
NCBI-ProteinID: XP_005290146
LinkDB
Position
Un
AA seq 181 aa
MESLLCTLVGERRIGEQMEWRPVKANRVRRNLFGPVDHEQLQQDFQHMLRSSMEGAQQKW
NFDFLRDIPAEGLLQWEELQSHDVPAFYHSCVVGEARKPLKPLNQGIVKEVKAHHFATVT
LTEHPKVAKKMSGKKSQAGKKRRQTSLTAPIYPPYHHLNSTSKSPINSEDLYSAPSGTRR
D
NT seq 546 nt   +upstreamnt  +downstreamnt
atggaatcgttgctctgtacgctcgttggtgagcggcggattggagagcaaatggagtgg
aggccagtgaaggcaaaccgtgtacgaaggaacctctttggccccgtggaccatgagcag
ctgcagcaggacttccagcatatgctgcgcagcagcatggagggagcccagcagaagtgg
aactttgacttcttacgagacataccggcagaggggctcctgcagtgggaagaactacag
agccatgatgtcccagccttttaccacagttgtgtggtgggtgaggctcgcaagcctttg
aagcccttgaaccagggtatagtcaaggaggtcaaggctcaccactttgccacagtgaca
ctgactgagcaccccaaagttgccaagaaaatgtcgggcaagaagagccaagcagggaag
aaacgaagacagacatccttgacagcacccatttatcctccatatcaccatctcaacagt
acatcaaaatctcccatcaactcagaagatctgtactctgctccctctggaacaagacgt
gactaa

DBGET integrated database retrieval system