KEGG   Chrysemys picta (western painted turtle): 101954164
Entry
101954164         CDS       T04662                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04012  ErbB signaling pathway
cpic04068  FoxO signaling pathway
cpic04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101954164 (CDKN1B)
   04068 FoxO signaling pathway
    101954164 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101954164 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101954164
NCBI-ProteinID: XP_005290147
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHCKDMEEACQRKW
NFDFQNHKPLAGKFEWQAVEKGSSPDFYFRLPRPPKVACKSAIHESLDVNGNCPTVIVVG
SQGISEDTHFVDQKTDVSENQTDLADQCSGQRKRPATDDSSPQPKRANTTEEEISEESPS
ASSVEQTPKKSSPRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgtatttcgaatgggagcccgaccctggagcggatggaagcccggcag
tcggagtatcccaagccttcagcttgcaggaacctctttgggcccgtgaatcacgaagag
ttaaacagggacttaaagaagcactgcaaggacatggaagaggcatgtcaaaggaagtgg
aattttgatttccagaatcacaagcccctggctggcaagttcgagtggcaagctgtggag
aaagggagctcgcccgacttctacttcagactgccgaggccccccaaagtcgcttgcaaa
tctgccatccatgagagtttggatgtaaatggaaactgcccaacggtgattgtagtcggt
tctcagggaatctcagaggacactcactttgtagatcaaaaaactgatgtatctgaaaat
caaacggacttagcagaccagtgcagtgggcaaagaaaacgaccagcgacggatgattct
tctcctcaacctaaaagagccaacacaacagaagaagagatttcagaagaatcccccagt
gccagctcagtggagcaaacacccaagaaatccagcccaagaagacgtcaaacgtaa

DBGET integrated database retrieval system