KEGG   Chrysemys picta (western painted turtle): 101954175Help
Entry
101954175         CDS       T04662                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04068  FoxO signaling pathway
cpic04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101954175 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101954175 (SOD2)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101954175 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101954175
NCBI-ProteinID: XP_005291601
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MLCRLASRGRSRTQLIAALGCSASRQKHTLPDLPYDYGALQPHITAEIMQLHHSKHHATY
VNNLNIAEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPQGELM
EAIKRDFGSFGNFKEKLTAVSVGVQGSGWGWLGFNQDQGRLQVTACYNQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVISWENVSARFTACKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgccgcctggcttcccggggcaggagtcgcactcagctgattgcagctttggga
tgttcggcctccaggcaaaaacacactcttcctgacttgccttatgactatggtgccctg
caaccccacatcactgcagaaatcatgcagctacaccacagcaaacatcatgctacttat
gtaaataatctgaatattgcagaggagaaatataaagaggcattggcaaaaggtgatgtt
acagctcaggtgtctcttcagcctgcactaaagttcaatggtgggggtcacatcaaccac
accatcttctggacaaacctttctcctaatgggggaggagagcctcaaggggaactgatg
gaagccatcaagcgtgactttggctcctttggaaacttcaaggagaagctgacggcagta
tcggttggtgttcaaggctcaggatgggggtggcttggttttaaccaggaccaaggccgt
ctgcaggtcactgcttgttacaatcaagaccctctgcaaggaacaacaggtcttattcct
ctgctaggaattgatgtgtgggagcatgcttattatcttcagtataaaaatgttagacct
gactatctaaaagctatctggaatgtgatcagctgggagaatgtatctgcaagattcaca
gcttgcaaaaaatga

DBGET integrated database retrieval system