KEGG   Chrysemys picta (western painted turtle): 103305684Help
Entry
103305684         CDS       T04662                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00500  Starch and sucrose metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103305684
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103305684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 103305684
NCBI-ProteinID: XP_008162551
LinkDB All DBs
Position
Un
AA seq 523 aa AA seqDB search
MRRAQAITERTMKVFLLLAAIGLCSAQYNPNTKPGKMSIVHLFEWRWADIALECERYLAP
NGFGGVQISPPNENIVITNPWRPWWERYQPISYNLCTRSGNYDEFKDMVTRCNNVGVHIY
VDAVVNHMCGSGAGSGNSSTCGSYFNAETRDFPAVPYSAWDFNDGKCKTGSGDIENYHDV
TQVRDCRLVSLLDLALEKDYVRSKVAEYMNELIDIGVAGFRIDASKHMWPGDMTAILDKL
KNLTKTWFSNGSRPFIYQEVIDLGGEPIKSSEYFGTGRVTEFKYGAKLGTVIRKWNGEKM
AYLKNWGEGWGFMPSDIALVFVDNHDTQRGHGAGGASVLTFWDSRLYKMALGFMLAHPYG
FTRVMSSYRWPRYFQNGKDINDWVGPPSSEDGSTKPVTINPDSTCGNDWVCEHRWHQIKN
MVIFRNVVDGQPFSNWWDNDSNQVAFGRGNRGFIVFNNDDWSLNVNLQTGLPAGIYCDVI
SGQKEGDCCTGIQVQVVGDGTANFQISNQAEDPFIAIHVDATL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagcacaagctattacggaaagaaccatgaaggtctttctcctgctagcagcc
attggactttgttcggcgcaatacaacccaaatacaaaacctgggaagatgtctattgtc
cacctgtttgaatggcgttgggctgacattgctcttgaatgtgaacggtatttagcaccc
aatggatttggtggagttcagatatctcctccaaatgaaaatattgtcattactaaccca
tggagaccctggtgggaaagataccagccaatcagctacaatctatgtacacgatctgga
aattatgatgaatttaaagacatggtgaccagatgcaacaatgttggagttcatatttat
gtggatgctgtagtcaaccacatgtgtggatctggtgctggctctggtaatagttctact
tgtggaagctatttcaatgcagagaccagagattttcctgctgtgccatactcagcctgg
gactttaacgatggtaaatgtaaaactggaagtggagacattgaaaattaccatgatgtg
actcaggtccgtgactgtcgccttgtcagtcttcttgatcttgccctggagaaggactat
gtgcgctcgaaagttgctgaatacatgaacgaacttattgatattggtgtggcaggcttc
agaattgatgcttccaagcatatgtggcctggggacatgacagcaattttagacaaactg
aaaaatctaactaaaacatggttttccaatggatcgagacctttcatttaccaagaggta
attgacttgggtggagagccaataaaaagcagtgaatactttggaactggccgagtgact
gaattcaaatatggtgccaaactgggtacggtgatccgcaaatggaatggagaaaagatg
gcctatttaaagaattggggagaaggctggggttttatgccctctgacatagcccttgtc
tttgtggataatcatgacacccaaaggggacatggtgctgggggagcttctgttctaacc
ttctgggactccagactatataaaatggcacttggctttatgcttgctcatccttatgga
tttacacgtgttatgtcaagttaccgctggccaagatattttcagaatggaaaggacatt
aatgattgggtgggaccaccaagctctgaggatggatcaaccaaacctgttacaattaat
ccagactccacttgtggcaacgactgggtctgtgaacatagatggcatcaaataaagaac
atggttattttccgtaatgtggttgatggccagcctttctcaaactggtgggacaatgac
agcaatcaagtggcttttgggcgtggtaatagaggattcatcgtctttaataatgatgac
tggagcttgaatgtgaatttgcaaactggccttcctgctggaatttactgtgatgttatt
tctgggcaaaaggaaggtgactgctgtacaggaatacaggtgcaggttgtaggtgacggc
actgctaacttccagattagtaaccaggctgaagatcctttcattgcaattcatgttgat
gctacattgtaa

DBGET integrated database retrieval system