KEGG   Chrysemys picta (western painted turtle): 103306489Help
Entry
103306489         CDS       T04662                                 

Definition
(RefSeq) homeobox protein NANOG-like
  KO
K10164  homeobox protein Nanog
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    103306489
Transcription factors [BR:cpic03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    103306489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Homeobox_KN Pro-kuma_activ
Motif
Other DBs
NCBI-GeneID: 103306489
NCBI-ProteinID: XP_008171644
LinkDB All DBs
Position
Un
AA seq 281 aa AA seqDB search
MDNVPHKEAADADVPVPEPEEKTLHNPELSPASSSSGTRMRYTPDSATSPNTEPPSPHPA
IRVGGVESGGGVKKAKSRTAFSQEQLQTLHQRFQSQKYLSPQQIRELGSALGLTYKQVKT
WFQNQRMKFKRCQKETQWMEKGTCLSQAGYLDLNPSYHQGCPVSASRNIQTVTNVHQSYG
SSQTYGNSQSLYPFVAIEEEGFFGKAGGACSAQQAMGFFSQQKMNFYHGFPANMDYASVE
TEDGYHFQNASVNATSFPGTAGCQQYQPAWHPQGTQSNYNS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgtcccccacaaagaggcagcagatgctgatgtcccggtcccagagccagag
gagaagaccctccataacccagagctctctccagcttcctccagctcgggaacacgcatg
cggtacaccccggactcagccaccagccccaacacggagcccccatccccacaccctgcg
atccgggtgggtggggtggaaagcgggggaggggtgaagaaggccaagagccgcacggcc
ttctcccaggagcagctgcaaaccctgcaccagcgattccagagccagaaatacctcagc
ccccagcagatccgggagctgggctcagccctggggctcacctacaagcaggtaaaaacg
tggtttcaaaaccaacggatgaagtttaaacgatgccagaaggaaactcagtggatggaa
aaagggacatgcctatcccaagcaggttacctggatttgaaccccagttatcaccagggt
tgtccagttagtgccagcaggaacatccagactgtgaccaatgtgcatcagagctatggt
agcagccagacctatgggaatagccagagcctgtatcccttcgtggctatcgaggaggag
gggttctttgggaaagccgggggagcctgcagcgcccagcaggcaatgggcttcttcagc
cagcaaaagatgaacttttatcatggcttcccggcgaacatggattatgccagcgtggag
acagaagatggctaccacttccagaatgcctctgtcaatgcaacgtccttcccgggcact
gctgggtgccagcagtaccagccagcatggcaccctcaagggacgcaaagcaactataac
tcttag

DBGET integrated database retrieval system