KEGG   Campylobacter pinnipediorum: CPIN18020_0893Help
Entry
CPIN18020_0893    CDS       T05033                                 

Gene name
gatB
Definition
(GenBank) Glu-tRNA(Gln) amidotransferase, subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cpin  Campylobacter pinnipediorum
Pathway
cpin00970  Aminoacyl-tRNA biosynthesis
cpin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPIN18020_0893 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cpin03029]
    CPIN18020_0893 (gatB)
Enzymes [BR:cpin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CPIN18020_0893 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CPIN18020_0893 (gatB)
Mitochondrial biogenesis [BR:cpin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CPIN18020_0893 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AQW86097
LinkDB All DBs
Position
863809..865230
Genome map
AA seq 473 aa AA seqDB search
MFEVIIGLEVHAQLNTDTKIFCSCSTSFGDEANTHVCPTCLALPGALPVLNKEAVRKAIS
FGAAVNATINKKSVFNRKNYFYPDLPKAYQISQFEIPIVENGELFIEVNGEKKRIGITRA
HLEEDAGKNIHEDGRSLVDLNRAGTPLLEIVSEPDLRSSDEAVAYLKKLHSILRFLNISD
ANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFKFIQKAIDYEVERQSIAWEDGNYD
EEVYQETRLFDTVNLTTRSMRGKEDSAEYRYFPDPDLLPVEISDEMYNECIKIPELADEK
VIRYQKEFGIKEEDALNLVNSIEMSRYFEDVVSENISPKLCVTWILVELLARLKNGLTIQ
NSPVDSKKMKELLKRIEDSTISAKAAKDVLDYLMQNDASVDEIIDKLGLKQVSDDGAIVE
IIKNILDKNQDKVLEYKNGKDKLFGFFVGQVMKEGKGAFNPAKVNELLNKALK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtaattattggacttgaggtgcatgctcaacttaatactgatacaaagatt
ttttgctcttgttctacaagttttggtgatgaggcaaatactcacgtgtgtccaacttgt
ttagccttacctggtgccttacctgtgttaaataaagaagctgtaagaaaagcgataagt
tttggcgctgctgtaaatgctactataaataaaaaatctgtgtttaatagaaaaaattat
ttttaccctgatttaccaaaggcttatcaaatttcacaatttgagatacctatagttgaa
aatggagaactttttatagaggtaaatggagaaaagaaaagaataggtataacaagggca
cacttagaagaagatgctggtaaaaatatccatgaagatggaagaagtttggttgattta
aatagggctggcacacctttgcttgaaatagtaagtgaacctgaccttagaagttctgat
gaggctgttgcttatcttaaaaaacttcactcaatactgagatttttaaatatttctgat
gcgaatatgcaagagggaagttttcgttgcgatgcaaatgttagtataagaccaaaaggc
gatacaaaactttatacaagggttgagattaaaaatctaaattcatttaaatttatacaa
aaagctatagattatgaggtagagcgccaaagtatagcttgggaagatggcaattatgat
gaagaggtatatcaagaaacaaggctttttgatactgtaaatttaacaactcgttctatg
cgtggtaaagaagatagtgctgaatatagatattttcctgatcctgatttgcttcctgtt
gaaataagcgatgagatgtataacgaatgcataaaaataccagagctagcagatgaaaaa
gtaataagatatcaaaaagagttcgggataaaagaagaagatgctttaaatttagtaaac
agtattgagatgagtagatattttgaagatgttgtgagtgaaaatatatcgccaaaactt
tgcgtaacttggatacttgttgaattactcgctagattaaaaaatggattaactatacaa
aatagtccagtagatagcaaaaaaatgaaagagcttttaaaaagaatagaagattctact
ataagtgctaaggcagcaaaagatgtacttgattatttaatgcaaaatgatgcaagtgta
gatgaaattatagataaattaggacttaaacaagtaagtgatgatggtgcaatcgttgaa
attattaaaaacatacttgataaaaaccaagataaagttttagaatacaaaaatggaaaa
gataagctttttggattttttgtaggacaggttatgaaagagggtaaaggtgcttttaac
ccagctaaagtaaatgaattattaaataaagctttaaaatga

DBGET integrated database retrieval system