KEGG   Campylobacter pinnipediorum: CPIN18020_1200Help
Entry
CPIN18020_1200    CDS       T05033                                 

Gene name
pfs
Definition
(GenBank) multifunctional 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase / 6-amino-6-deoxyfutalosine hydrolase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
cpin  Campylobacter pinnipediorum
Pathway
cpin00130  Ubiquinone and other terpenoid-quinone biosynthesis
cpin00270  Cysteine and methionine metabolism
cpin01100  Metabolic pathways
cpin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CPIN18020_1200 (pfs)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CPIN18020_1200 (pfs)
Enzymes [BR:cpin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     CPIN18020_1200 (pfs)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     CPIN18020_1200 (pfs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 TRIC HTH_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AQW86393
UniProt: A0A1S6U8N7
LinkDB All DBs
Position
complement(1176476..1177159)
Genome map
AA seq 227 aa AA seqDB search
MIAILGAMEEEITPILESLENYETISYATNKFYISNYKGKDIVVAYSKIGKVNSTITASI
MIERFKAQKLIFTGVAGALRDDLKIGDLFYATSLAQHDLDITAFGHPNGYVPGIEIFTKT
DDGLNEIAKKVAGNKSIDLKSGIIATGDQFICKQSIKDWIKDTFKADVVEMEGASVAQVC
KQLGIPFFMLRAISDEAGGGAEFDFDEFLKSSAKLSAEFVLSMVEEL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgattctcggagcaatggaagaagaaataacacctattttagaatctcttgaa
aattatgaaactatatcgtatgctacaaataaattttatatatcaaactataaaggcaaa
gatatagtagtggcttattctaagataggcaaggtaaattccactataactgctagtatt
atgattgaaagatttaaagcacaaaaactcatttttacaggggttgctggtgctttaagg
gatgatttgaaaatcggtgatctgttttatgctacatcactagcgcaacacgacctcgac
attacagcttttggacatccaaatggatatgttcctggtatagaaatttttaccaaaaca
gatgatggattaaacgagatagctaaaaaagttgctggcaataagtctatagatttaaaa
agtggaattatagcaacaggcgatcagtttatatgtaaacaatccatcaaagactggata
aaagatacatttaaggcggatgtagttgagatggagggtgcaagtgttgcacaagtttgc
aaacagttaggtattccattttttatgcttagagcgataagtgatgaggctggtggcggt
gctgagtttgattttgatgaatttcttaaaagttcagctaagcttagtgccgagtttgtt
ttaagtatggttgaagaattatga

DBGET integrated database retrieval system