KEGG   Chryseobacterium piperi: CJF12_06940Help
Entry
CJF12_06940       CDS       T05071                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00620  Pyruvate metabolism
cpip00680  Methane metabolism
cpip01100  Metabolic pathways
cpip01120  Microbial metabolism in diverse environments
cpip01200  Carbon metabolism
Module
cpip_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CJF12_06940
  09102 Energy metabolism
   00680 Methane metabolism
    CJF12_06940
Enzymes [BR:cpip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CJF12_06940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4299 DUF3437
Motif
Other DBs
NCBI-ProteinID: ASW74055
UniProt: A0A086BJQ3
LinkDB All DBs
Position
complement(1566247..1568781)
Genome map
AA seq 844 aa AA seqDB search
MIHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESKNGYEAGKTPEEI
VEEFFRSHTDLKTEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDNGTVTNLFE
RSQQDHKLEKVREKLKDFTVKVVFTAHPTQFYPSSVQRIIQDLRSAITTDSVTNIDMLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRYVYYDTIGELFTKIRTTFGNGHFHLHEDIIQLG
FWPGGDRDGNPFVTADVTQRVAEELRSAILKSYYSHLKYVRRRLSFRGVSEVLQELNDEL
YAAIFNNQKLTTEDILKRVEEAERILITHHNSLFLDLIVNFKDRVKIFGTHFATLDVRQD
SRIHQQVIDEVFAKINGDADASQNDKFNQLIQVSTPVNPEDFEGIVKDTLLTVAQVKEIQ
EQNGLRGMSRYIISNSDAVKDVMNVYAFFKICGYKDEDINMDIVPLFETMEGLHNAESVM
NELYQNPVYKKHLEKRGQQQTIMLGFSDGTKDGGYLKANWEIYKAKEVLTKLSEQNGIKV
VFFDGRGGPPARGGGKTHDFYASQGKTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNAKKELTEKERKLITELAEISYKKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGNGDELRFEDLRAIPFVGSWSQLKQNVPGFFGFGFAMEEMKKQGRFEEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKNNTKFGEFWNVLFEEYNLSKDIMLELTGF
SMLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGDKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatacacgaccaacgcgcagaaaaattcaggcagattgtagaaaataaatttcagatc
tacaattcattatttatgagtctgccttatgataaaatgactaatatcgggatgcttctc
ccgtttttatatgaggaaagtaaaaatggctatgaagctggaaaaactcctgaagaaatt
gtagaagagtttttcagaagtcataccgacctcaaaactgaagagcagaaactggagttg
ctttttaaaattattcagtatatagaaagacaggtggttttgtttgacagtatagaagat
gctgcattccctaacctgcattcagaaagtgataatggaacggtaacgaatctttttgaa
cgttcccaacaagatcataagcttgaaaaggtacgtgagaaattaaaagactttactgta
aaagttgtttttactgcacacccgacccagttttatccgagctctgtacaaaggattatc
caagatctaagatctgctattactacggattctgtgaccaatattgatatgctgcttcag
cagttgggaaaaactccttttgtaaataaagaaaagccgactccgattgatgaggctctg
agtatcatctcttatttgagatatgtatattatgataccattggggagttgtttacgaaa
atcagaacgacttttggaaacgggcattttcaccttcatgaagatattattcaacttgga
ttctggccgggaggagatcgtgatggaaatccttttgtgacagcagatgttactcaaaga
gttgcggaagagctccgttcagctattttaaaatcatattacagtcatctgaaatatgta
aggagaagattgagcttccgtggcgtttcagaagtattgcaggagttgaatgatgaatta
tatgcagccatttttaataatcagaaactgaccactgaagatattctcaaaagagtagag
gaagctgagcgtattcttattacccatcataattctttgtttttagacctgattgtcaat
ttcaaagaccgggttaaaattttcgggactcacttcgctaccctggatgttcgtcaggac
agtagaattcatcagcaggtaattgatgaggtttttgcaaaaataaatggtgatgcggat
gccagccaaaatgacaaatttaatcaattgattcaggtatcaactccggtaaatcctgag
gattttgaagggatcgtaaaagatactttactgactgtcgctcaggttaaagaaattcag
gagcagaacggattaagaggaatgagtcgatatattatttctaattctgatgcggtgaaa
gatgtgatgaatgtatatgcattctttaaaatctgtggttacaaagatgaagatatcaat
atggatattgttccgttatttgaaactatggaagggcttcacaatgcagaaagcgtaatg
aatgagctttatcagaatccagtatataaaaagcatcttgaaaaaagagggcagcaacag
acgatcatgcttggtttttcagatggaaccaaagatgggggatatctgaaagctaactgg
gaaatttataaagctaaagaggttttaacaaagctttctgagcagaatggaataaaagta
gtgttctttgacggaagaggaggaccacctgcaagaggaggaggaaagacccatgatttc
tatgcttcacaaggaaaaacaatagctaataataaaattgaattaaccattcaggggcag
acgattaccagcattttcggaaataaagagcaggcaaaatataattttgaacagctttta
actgccggtgttgaaaatgatgtctttaagaatgctaaaaaagagctcactgaaaaagaa
agaaaactgattactgagttggctgaaatcagctataaaaaatattcggatttgaaggct
catcctatgtttgtaccttatttacaggaaatgagtacactcgagtattatggaaaaaca
aatatcggaagcagaccttcaaaacgaggaaatggagatgagcttaggttcgaagacctg
agagctattccgtttgtcggatcatggtcacagctaaagcaaaatgtgcccggattcttt
ggatttggctttgctatggaggaaatgaaaaagcagggaaggtttgaagaagtaagagaa
ttgtataaaggttcggacttctttaaaactttagttttaaactccatgatgagtatgaat
aaatcttatttcccactgacttactatatcaaaaacaatactaaatttggagaattctgg
aatgtactttttgaggaatataacctttccaaagatattatgctggaactgacagggttt
tcaatgctccaggaagaagatccgctttcccgaaaatccgtaaaaatccgcgagaaaatt
gtattaccattattgagtatccaacaatatgctttaatgaaaattcagaaaggagaggga
gataaagaagcctatgaaaaattagtgacacgttctctgtttggaaatatcaatgcgagt
agaaattcagcataa

DBGET integrated database retrieval system