KEGG   Chryseobacterium piperi: CJF12_12180Help
Entry
CJF12_12180       CDS       T05071                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00564  Glycerophospholipid metabolism
cpip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJF12_12180
Enzymes [BR:cpip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CJF12_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 Thi4 FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ASW74965
UniProt: A0A086BF12
LinkDB All DBs
Position
2754923..2756518
Genome map
AA seq 531 aa AA seqDB search
MKRIEELNKLASTREWDFIIIGGGASGLGSALDATTRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGDVGLVKEALKERGLLAKNAAHIVKNQSFIIPNYTWWGGIYYKIGLSVYD
FLAGKLSLGKTQYISKSKTVAKLPTIEQNHLVSGVVYQDGQFDDSRLAINLAQTIIEKGG
CAINYIKVVNLLKNESDTVIGVVAEDQLTKKQYEINAKVVINATGVFTNDILNMNNPKHG
KLVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLKDESFEP
RALEEEINFVLNTARQYLAKKPTREDVKSVFAGLRPLAAPKDGSKSTKEVSRSHKVIASE
TGLISIIGGKWTTYRKMAEDTVDEAMKVHRLGNTPSKTEHLSIHGNVKPDQVDRSNHLYV
YGSDIPAIKALQESNPEYAKRIHPDHAFTVAEVIWAVRNEMAETIEDVLARRVRLLFLDA
RAAIDSAHKIASIIAEEKGFNEEWANQHEKEFIELAKGYLLAPYSPKTINP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattgaagaattaaataaattagccagcacccgtgaatgggactttattatt
ataggaggtggtgccagtggcttaggttctgctctagatgcaacgaccagaggattcaaa
acattgcttttagaatctcatgactttgcaaaagcaacatccagcagaagtacaaaactt
gtacatggtggagtgcgatatcttgcgcagggagatgtaggattagtaaaagaggcttta
aaagaaagaggattacttgctaagaatgcagctcatattgtaaaaaatcaatcattcatt
atccctaattatacatggtggggaggtatctattataaaataggattatctgtttatgat
tttcttgccggtaaactaagtttaggtaaaacacaatatatcagtaaatctaaaactgtt
gccaagcttccaactatagaacaaaatcatctggtaagtggagttgtttaccaggatgga
cagtttgatgattcccgtttggcgatcaatttagcacaaaccattattgaaaaaggagga
tgtgcaatcaactatattaaggtagttaacctacttaagaacgagtccgataccgtgatc
ggtgttgtagctgaagatcaactgactaagaaacagtacgaaatcaatgcaaaagtcgtg
atcaatgcaaccggtgtatttaccaatgatattcttaatatgaataatccaaaacatggt
aaactggttgttccaagtcaagggattcatctggtattggataaatctttccttaagagt
gatgacgctattatgattcctaaaacttcagatggcagggttctgtttgttgtgccttgg
cacgacagagctttagtaggaacaacggatacactcttgaaggatgaaagttttgaacct
cgtgctttagaagaagagatcaattttgttttaaatacagccagacaatatttagctaag
aaaccaacccgcgaagatgtaaaatcagtattcgcaggactccgtcctcttgcagctcct
aaagatggcagcaaaagcacaaaagaggtttcccgaagccataaggtgatcgcttccgag
actggattaatttctatcattggaggaaaatggactacctaccgtaaaatggcagaggac
actgtggatgaagccatgaaagtacacagattagggaacaccccttctaaaacagagcat
ctttctatccatggaaatgtaaagcctgaccaggtagacagaagtaatcatctatacgtt
tacggatctgatattccagccataaaagctttgcaggaaagcaaccctgaatatgcgaaa
aggattcatcctgatcacgcatttacggtagcagaagtgatatgggctgtaagaaatgaa
atggcagaaaccatagaggatgttctggccagaagagtgcgtttattatttttagatgcg
agagctgcaatagacagcgcacataaaatagcatctattattgcagaagaaaaaggattt
aatgaagaatgggcgaatcaacacgaaaaagaatttattgaattagcaaaagggtattta
cttgccccttactcacctaaaacaatcaacccttaa

DBGET integrated database retrieval system