KEGG   Chryseobacterium piperi: CJF12_16755Help
Entry
CJF12_16755       CDS       T05071                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cpip00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CJF12_16755 (ligD)
Enzymes [BR:cpip01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CJF12_16755 (ligD)
DNA repair and recombination proteins [BR:cpip03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CJF12_16755 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2 GH3
Motif
Other DBs
NCBI-ProteinID: ASW75768
UniProt: A0A086BLV6
LinkDB All DBs
Position
complement(3797583..3799469)
Genome map
AA seq 628 aa AA seqDB search
MLAKSFEKAFDDKEWVFEIKWDGYRAVADLRNEEPLFYSRNGISFLSKFEKVARDFSRQK
YKMVIDGEIVAYNNEGRPDFQLLQQIGDHPDLALVYQVFDLLWLNGHSTEDLPLIQRKEL
LKEALVETDTIKYCDHIPEKGIAFFNQMKKMKLEGMIAKKSNSLYLENYRNSDWLKIKFT
NTDEAIICGFTEPRGSRKGFGALILGKYIGDQLIYSGHTGTGFNAESLSKLHEELKKLVI
KQSPFEDIPKTNMPVTWVKPELVCEIKYSEITKDGIFRHPVFIAIREDKEPEDIKGTTDK
TKPSKEKLKEMKAKTSSKKTDTTSEKEKEITLNRHSVKLTNQDKIYFPKDGITKGDVVEY
YQSIADYILPYLKNRPLSLNRFPNGIEEQGFYQKDASDHIPEWVKTTKVYSESNDKYIDY
IYCNDKATLAYLNNLGCIDLNPWNSSLPDLEHPDYLVLDLDPSKKNTFDDVIETALQVNE
VLNSIKIKGYCKTSGSTGIHIYIPMGGKYDFEQVKDFAHILMKQVYDKLPKITTLERSLQ
KRDDKKIYLDYLQNRTGQTLASAYSLRPKEGASVSMPLEWDELKPGLKPTDFNIHNALDR
IKEKGDLFKPVLGKGIDMVKALDLLQNL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccaaatcctttgaaaaagcatttgatgataaagaatgggtttttgaaataaaa
tgggacggatacagagcggttgcagatctcagaaatgaagaacctcttttctattcaaga
aacggaatttcctttctatcaaaatttgaaaaagtagcacgggatttcagccggcaaaaa
tataaaatggttatagacggtgagattgttgcttataacaatgaaggaagacctgacttt
caactactacaacaaatcggagatcatcccgatttagctttggtttatcaggtatttgac
ctgctttggcttaatggccattctaccgaagatcttccgcttatccaacgaaaggaatta
ttaaaagaagcattggtagaaactgataccatcaaatattgtgaccatattcctgaaaaa
ggcattgcatttttcaaccagatgaagaaaatgaaactggagggcatgattgctaaaaaa
tcaaacagcctctatctcgaaaattacagaaatagtgattggcttaaaataaaatttacc
aataccgatgaagctattatctgtgggtttacagaacccagagggtcgagaaaaggcttt
ggagctttgattttggggaaatatataggagatcagttaatttactcaggccatacagga
acaggctttaatgcagagtctcttagcaagctgcatgaagagttgaaaaaacttgtcata
aaacaatccccttttgaagatattcctaaaaccaatatgccggtcacctgggtaaaaccg
gaattggtatgtgaaataaaatattctgaaattacaaaagacggtatcttccgccatccg
gtttttatagcaattcgtgaggataaagaaccggaagatattaaagggacaacagacaaa
acgaaaccctccaaagaaaaacttaaagaaatgaaagctaaaacctcttccaaaaaaacc
gacacaacatctgaaaaagaaaaggaaatcacattaaaccggcattccgtaaaactcacc
aatcaggataaaatatattttccaaaagacggcattaccaaaggtgacgttgtggaatat
tatcaatctattgcagattatattctcccttatttgaagaatcgtccattatctttaaac
cgtttccccaatgggattgaagaacagggtttttatcagaaagatgcgagtgatcatatt
cctgaatgggttaaaacaacaaaggtctactcagaatctaatgataagtatatcgattat
atttattgtaatgataaagcaacgttggcttacctcaataatctaggatgcattgacctc
aatccctggaatagttcactcccggatctggaacatcctgactaccttgtcttagacctt
gatccttcaaagaaaaatacatttgatgatgttattgaaactgcccttcaggttaacgaa
gttttaaattcaattaaaattaaaggatattgtaaaacatcaggaagtactggaattcat
atctatattcctatgggtggaaaatatgattttgaacaggtgaaagatttcgctcatata
ttgatgaaacaagtttatgacaagcttcccaagataaccacattagaaagaagtttacaa
aaaagggacgataagaaaatttatctcgattacctgcaaaaccgaacaggacaaacatta
gcaagtgcttatagcttaagacctaaagaaggagcttctgtttcgatgcctttggaatgg
gatgaactgaaaccaggtttaaaacctactgattttaacattcataatgctctggacaga
attaaagaaaaaggagatttgtttaaaccagttttaggaaagggaattgatatggtaaaa
gcgttagatctattgcaaaacctttag

DBGET integrated database retrieval system