KEGG   Chlamydia pneumoniae J138: murC_ddlAHelp
Entry
murC_ddlA         CDS       T00032                                 

Gene name
murC_ddlA
Definition
(GenBank) muramate-Ala ligase/D-Ala-D-Ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cpj  Chlamydia pneumoniae J138
Pathway
cpj00471  D-Glutamine and D-glutamate metabolism
cpj00550  Peptidoglycan biosynthesis
cpj01100  Metabolic pathways
cpj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    murC_ddlA (murC_ddlA)
   00473 D-Alanine metabolism
    murC_ddlA (murC_ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    murC_ddlA (murC_ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    murC_ddlA (murC_ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpj01011]
    murC_ddlA (murC_ddlA)
Enzymes [BR:cpj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     murC_ddlA (murC_ddlA)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     murC_ddlA (murC_ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cpj01011]
 Precursor biosynthesis
  Amino acid ligase
   murC_ddlA (murC_ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp ATPgrasp_YheCD RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAA99113
UniProt: Q9Z701
LinkDB All DBs
Position
1036730..1039159
Genome map
AA seq 809 aa AA seqDB search
MKGTPQYHFIGIGGIGMSALAHILLDRGYEVSGSDLYESYTIESLKAKGARCFSGHDSSH
VPHDAVVVYSSSIAPDNVEYLTAIQRSSRLLHRAELLSQLMEGYESILVSGSHGKTGTSS
LIRAIFQEAQKDPSYAIGGLAANCLNGYSGSSKIFVAEADESDGSLKHYTPRAVVITNID
NEHLNNYAGNLDNLVQVIQDFSRKVTDLNKVFYNGDCPILKGNVQGISYGYSPECQLHIV
SYNQKAWQSHFSFTFLGQEYQDIELNLPGQHNAANAAAACGVALTFGIDINIIRKALKKF
SGVHRRLERKNISESFLFLEDYAHHPVEVAHTLRSVRDAVGLRRVIAIFQPHRFSRLEEC
LQTFPKAFQEADEVILTDVYSAGESPRESIILSDLAEQIRKSSYVHCCYVPHGDIVDYLR
NYIRIHDVCVSLGAGNIYTIGEALKDFNPKKLSIGLVCGGKSCEHDISLLSAQHVSKYIS
PEFYDVSYFIINRQGLWRTGKDFPHLIEETQGDSPLSSEIASALAKVDCLFPVLHGPFGE
DGTIQGFFEILGKPYAGPSLSLAATAMDKLLTKRIASAVGVPVVPYQPLNLCFWKRNPEL
CIQNLIETFSFPMIVKTAHLGSSIGIFLVRDKEELQEKISEAFLYDTDVFVEESRLGSRE
IEVSCIGHSSSWYCMAGPNERCGASGFIDYQEKYGFDGIDCAKISFDLQLSQESLDCVRE
LAERVYRAMQGKGSARIDFFLDEEGNYWLSEVNPIPGMTAASPFLQAFVHAGWTQEQIVD
HFIIDALHKFDKQQTIEQAFTKEQDLVKR
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaactcctcagtatcattttatcggtatcggtggtataggaatgagcgcttta
gctcatattttgcttgatcgtggctatgaggtctctggaagcgacttatatgaaagctat
acgatcgaaagcctgaaagctaaaggtgcgaggtgtttctcaggccatgattcctcccat
gttcctcatgatgccgtcgttgtttatagctcaagtatagcccctgataatgtagagtat
cttaccgctattcaaagatcatcacgtcttcttcatagagcagagctcttgagtcagctt
atggagggttatgaaagcattctggtttcaggaagccatgggaagacagggacctcatct
ctaattcgagcgattttccaggaagctcagaaagatccctcctatgctattggaggactc
gctgcaaactgcctgaatgggtattctggatcatcgaaaatcttcgttgccgaagccgat
gaaagtgatgggtctttaaagcactacactccccgtgcagtagtcattacaaatatagat
aatgaacatttgaataattacgctgggaatcttgataacctggttcaggtaatccaggac
ttctctagaaaagtaacagatctcaataaggtattctataacggggattgtcctattttg
aaaggaaatgtccaagggatttcttatggatattcaccagaatgtcaattgcatatcgtt
tcctataatcaaaaggcatggcaatctcacttttcctttacctttttaggccaggagtat
caagacattgagctcaatctccctggacaacataacgctgcaaatgcagcagcagcctgt
ggagttgctcttacctttggcatagacataaacatcattcgaaaagctctcaaaaaattc
tcgggagttcatcgacgtctagaaagaaaaaatatatccgaaagctttcttttcttagaa
gattatgctcatcatcctgtagaggttgcacataccctgcgctctgtgcgtgatgctgtg
ggtttgcgaagagtcatcgcaatttttcaaccacatcgattctctcgtttagaagagtgc
ttacaaaccttccccaaagctttccaagaagctgatgaagtcatacttacagatgtctat
agtgccggagaaagtcctagagagtctatcattctttccgaccttgcggaacagattcgt
aagtcttcttatgtccattgttgttatgttccccatggagacatcgtagattatctacga
aactacattcgcattcatgatgtctgtgtttctctaggagctggaaatatctatactatt
ggagaggctttaaaagactttaaccctaaaaaattatccataggactcgtctgtggaggg
aaatcttgcgaacacgatatttctctactttctgctcaacatgtctctaaatatatttct
cctgaattctatgatgtgagttacttcatcataaatcgtcagggcttatggagaacagga
aaggattttcctcatcttattgaagagactcaaggggattcgccactttcttctgaaatc
gcttcagctttagcaaaagtcgactgtttgtttcccgtgctccatggcccatttggagag
gatggtacgatccagggattttttgaaatcttaggaaaaccttatgccggaccctcacta
tctttagcagcaactgcaatggataagctgttaacaaaacgaattgcatcagcagtgggt
gttcctgtagtcccttaccaacctttaaatctctgtttctggaaacgcaatccagaacta
tgtattcagaatcttatagagacattttctttccctatgattgtaaaaactgcacatttg
ggatctagtattgggatatttttagtccgtgataaagaggaattacaagaaaagatctca
gaagcatttctatatgacacggatgtgtttgtggaggaaagtcgcttagggtctcgtgaa
atcgaagtgtcctgtatcggccattcttctagctggtattgtatggcagggcctaatgaa
cgctgtggtgctagtgggtttattgattatcaagagaaatatggatttgatggcatagat
tgcgcaaagatctcttttgatttacagctctcacaagaatctttagattgtgttagagaa
cttgcagagcgtgtctaccgagcaatgcaaggaaaaggttcagctcgaatagattttttc
ttggatgaagaggggaattattggttgtcagaggtcaatcctattccaggaatgacagca
gctagcccatttttacaagcttttgttcacgcaggatggacgcaagaacaaattgtagat
cactttattatagatgctctacataagtttgataagcagcagactatcgaacaggcattc
actaaagaacaagatttagttaaaagataa

DBGET integrated database retrieval system