KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0243Help
Entry
Cp1002_0243       CDS       T01876                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00020  Citrate cycle (TCA cycle)
cpk00190  Oxidative phosphorylation
cpk00650  Butanoate metabolism
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp1002_0243 (sdhA)
   00650 Butanoate metabolism
    Cp1002_0243 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cp1002_0243 (sdhA)
Enzymes [BR:cpk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cp1002_0243 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Cp1002_0243 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADL20146
LinkDB All DBs
Position
257374..259389
Genome map
AA seq 671 aa AA seqDB search
MSFNSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEYQKDHMNLVSPLNRRK
FTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGA
YRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLILTDENGKKACRGIVTRNL
ITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRAYELGAYLASPSFIQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSAYLDFRDSIERLGENTIRERYSNLFQMYEEAIGENP
FKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLANHLGEAKLAEDAPEAVAAVARAQARIDKLMNIKGDDPHGPEHYHRQLG
DILYFSCGVARNVEDLKTGIEKIRKLRKEFWSNLRITGEAEEMNQVLEYACRVADYIDLG
ELMCVDALDRDESCGAHFREDHLSSEGEAERDDENWCFVSAWEPGAQEHEFIRHAEPLTF
ESIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaactctgaaaccgctactcgccctgagttcacccagccagcttccatcgtc
gatggcgtaaagctgggcagcatccttgaatccaacgagcccaagggcgttcctaccaag
gacatgtgggagtaccaaaaagaccacatgaacctggtttccccactgaaccgtcgtaag
tttacggtccttgttgtgggaaccggactttccggtggcggcgctgctgctgccctcggt
gaactgggatacaacgtgaaggtcttcacgtaccatgacgctcctcgtcgtgcgcactcc
attgctgcgcagggtggtgtgaactccgctcgcggtaagaaagtggacaacgacggtgct
taccgccacgtgaaggacactgtgaaggggggcgactaccgctgccgcgagtccgattgt
tggcgcttagcgtatgaatccgtacgcgtcatcgaccacatgaacgccattggtgctcct
ttcgctcgcgaatacggtggaaccttggctactcgttccttcggtggcgtgcaggtttcc
cgtacgtattacacgcgtggtcaaacaggccagcagctgcaattgtccggtgctgcagca
ttgcagcgtcagattggcctcgggactgtggagatctttacgcatgcagacatgcatgat
ctgatccttacagatgaaaacggcaagaaagcctgccgcggtattgtcacccgtaacctg
atcacaggcgagctcactcctcatacgggccatgcagtcatcctggctactggcggttac
ggcaacgtctatcacatgtctacgctggctaagaactccaacgcatcggcaatgatgagg
gcgtatgagctcggcgcttatttggcttctccgtctttcattcagttccacccgacaggc
cttccggttaactcggaatggcagtcgaagacgatcctgatgtccgagtctttgcgtaac
gacggccgcatctggtccccactcgagcccaaagacgatcgcgatcccaacacgatccct
gaagaagagcgcgactacttccttgagcgccgctacccggcattcggtaatctcgtgcct
cgcgacgtagcatcgcgtgctatttctcagcagatcaacaagggactcggcgttgggcct
ctgcacaactccgcttacctggacttccgcgattccattgagcgtcttggtgagaacaca
atccgtgagcgttattccaacctcttccagatgtatgaagaggcaattggtgagaaccca
ttcaaggctccgatgcgtattgccccgacttgccacttcaccatgggcggcttgtggacg
gactttaatgagatgacctctatcgacggtctctttgccgcaggtgagtgctcctggacc
tatcacggtgcaaaccgtctgggcgctaactccctgctttctgcctctgtcgatggctgg
tttaccttgccgtttactattccgaactacttggctaaccaccttggagaggccaagcta
gctgaggatgctcctgaagcagttgctgccgtggcacgagctcaggctcgcatagacaag
ctcatgaacattaagggcgatgatcctcatggtcctgagcattatcaccgccagctgggc
gatatcctctacttctcttgtggcgttgcccgtaacgttgaagatctgaagaccggtatt
gagaagattcggaaactccgtaaggaattctggtccaacctccgcattaccggtgaggca
gaagagatgaaccaggttcttgagtacgcatgccgcgtagctgactacatcgacctcggc
gagctcatgtgcgttgacgcgctcgaccgcgatgagtcctgtggtgcgcacttccgtgaa
gatcatctctcttctgagggtgaggcagagcgtgacgacgaaaactggtgctttgtttcc
gcttgggagccaggcgcacaggaacacgagttcattcgccatgctgagccactcacattc
gaatcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system