KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0244Help
Entry
Cp1002_0244       CDS       T01876                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00020  Citrate cycle (TCA cycle)
cpk00190  Oxidative phosphorylation
cpk00650  Butanoate metabolism
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp1002_0244 (sdhB)
   00650 Butanoate metabolism
    Cp1002_0244 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cp1002_0244 (sdhB)
Enzymes [BR:cpk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cp1002_0244 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Cp1002_0244 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_15 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ADL20147
LinkDB All DBs
Position
259389..260138
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPHSEGHFESIDVEDAVAQMSILELLDHVNTGLVEEGKEPFVFASDCRE
GICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRSAAYPVIKDLAVDRSAL
DRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADVCPAGIPLSAVAAINKERA
RAFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatttggcgtcaggccggtcctcacagcgaaggtcatttcgag
tccatcgacgtcgaggacgccgtagcgcagatgtctatccttgagctgctggaccacgtc
aacactggcctggttgaggagggcaaagagccctttgtctttgcttcggactgtcgtgaa
ggcatctgtggcacctgtggcctgttggttaacggacgtccgcatggcctggacaagaac
aagccttcctgccagcagcgccttgatcacgtggcagatggttcgaccctcaagatcgag
cctttccgttctgctgcttacccagtgatcaaggacctcgctgttgatcgctcggctctt
gaccgagtgatgcaaaagggtggctacgtttcaatcaatgccggcacggctccggacgca
gacaccatttaccagaaccacgagaaagctgagcttgctcttgaccatgctgcatgcatc
ggttgtggcgcctgtgtagctgcgtgccccaacggtgcagcgcacctgttcacgggagca
aagcttgtgcatctcgctcttatgcctttgggtcgtgaagagcgtggcaagcgtgcccgc
aatatgattgatgagcttgagaccaactttggtcactgctcgctgtatggcgagtgcgca
gatgtctgcccggcaggcattccgctttccgccgtcgcagctatcaacaaagagcgggcc
cgcgctttcttccgtggtaaggacgactaa

DBGET integrated database retrieval system