KEGG   Chlamydia pecorum E58: G5S_0339Help
Entry
G5S_0339          CDS       T01466                                 

Definition
(GenBank) putative protein kinase
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Seadorna_VP7 Kdo SpoIIE FTA2
Motif
Other DBs
NCBI-ProteinID: AEB41345
LinkDB All DBs
Position
353013..354506
Genome map
AA seq 497 aa AA seqDB search
MDCRANADPETLSVGGYPQKKILSRKEGSTVYQSEHPESLQPVVVKVLSPPYVFDSRRVE
GFLREIHILRQASHPNIVTFYNYGKWGNHLYVAMEYIEGITLRHYILSQCIPLTRAIDIL
IEILKAVDYLHSQGVIHKDIKPENILLSLRGQVKLIDFGLAAWGVEEISGRSAVLGTPYY
MSPELRQGEPFSEASDVYALGLLAYELILGNLSFGKVHLSLIPAKIGRILAKALQPSTKA
RYSSAKEFLQDLQDYRLSEDITQDFRKKDYAINVGEQLREQGVWLAPQELSFPSFVAGSL
YQLGYSSHPYAYYDAFFIDEVFHLWLGYSTTSNATLALSALKSLVAQQDPELPPIERVRK
INEQLKHMQIPIDEAGVSIVCVTMFPNADVFSWIACGQTVFWLKTRGISRNYKTSSPGLG
KINSLQIQESKVAWEIGDEAILRTLHAEDSNALSFAELQDRRQTAIFCPIEHVRYGTPGN
VNESSSPSTLISLKRIR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcgtgccaatgctgatccggagactttatccgtaggtgggtatccacaaaaa
aagattcttagtcgtaaagaggggagcacagtttatcaaagtgagcatcctgagtcgcta
cagcctgtcgtggtgaaggtgctttctccaccttatgtttttgattcccgtcgtgtggag
ggtttccttagagaaatccatattctccgtcaggcgtcacatccgaatattgtaacgttt
tataactatggcaaatgggggaaccatttgtatgttgctatggagtatatcgaagggatt
acattgcgacattacatcctctcccaatgtattcccttaacccgcgctatagatattctt
attgagattcttaaggctgtagattacctccacagtcagggagtaatccataaggatatc
aagcctgaaaacatcttgctgtctttgcgagggcaggtcaaacttatagactttggtttg
gcagcttggggagtagaagaaatctccgggcgctctgcagtgttggggacaccttattat
atgagccccgagttgcggcagggagaacctttttctgaagcttctgatgtctatgccttg
ggattattagcatatgagctgatcttggggaacctttcttttgggaaggtacatctttct
cttattcctgcgaaaattggaaggattcttgcgaaagcgttacagccttctacaaaagct
cgttacagctctgcgaaagaatttttgcaagatttgcaagactaccgtctttctgaagat
ataacgcaagattttcgtaagaaagattatgcaatcaatgtaggagagcagttgcgagaa
caaggtgtctggcttgcaccgcaagaattgagtttcccttcgtttgtggcggggagcctg
tatcagctaggatactcttcacatccctatgcgtattatgatgcgtttttcattgatgag
gtgtttcatttgtggttagggtatagtaccacgagcaatgctaccttggctttgtcggcg
ttaaagagtttagtagcgcagcaggatcctgagctccccccgatagagagagtacgcaag
atcaatgaacagctaaagcacatgcaaattcctatagatgaagctggcgtgagtatcgtt
tgtgttaccatgtttccaaatgcggatgtattttcgtggatcgcttgtggccaaacagtt
ttttggctaaaaacacgtgggatttcccgaaactataaaacttcttctccaggattaggg
aaaattaattctttacaaattcaggaaagcaaggttgcatgggaaataggtgatgaggcg
atcttgcgcacattacacgcagaagattcaaacgcattgtcattcgcagagttgcaagat
agaaggcaaacagctatattctgccctatagagcatgtgcgctatgggactccaggaaat
gtcaacgaaagctcttctccttcaacgcttattagcttaaaaagaatccggtga

DBGET integrated database retrieval system