KEGG   Chlamydia pneumoniae CWL029: CPn0057Help
Entry
CPn0057           CDS       T00021                                 

Gene name
sodM
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpn  Chlamydia pneumoniae CWL029
Brite
Enzymes [BR:cpn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPn0057 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 894772
NCBI-ProteinID: NP_224265
UniProt: Q9Z9C4
LinkDB All DBs
Position
72934..73557
Genome map
AA seq 207 aa AA seqDB search
MSFVPYSLPELPYDYDALEPVISSEIMILHHQKHHQIYINNLNAALKRLDAAETQQNLNE
LIALEPALRFNGGGHINHSLFWETLAPIDQGGGQPPKHELLSLIERFWGTMDNFLKKLIE
VAAGVQGSGWAWLGFCPAKQELVLQATANQDPLEPLTGKLPLLGVDVWEHAYYLQYKNVR
MDYLKAFPQIINWGHIENRFSEIISSK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgttccttattctttaccagagttaccctatgattatgacgctttggagcct
gtaatttcttctgaaattatgattttacaccaccaaaagcatcatcagatctacattaat
aatcttaacgcggctttgaagagattagatgctgcagaaacacaacaaaaccttaatgaa
ctcattgctttagaacccgctctccgctttaacgggggaggacacatcaaccactctcta
ttctgggaaactcttgctcctatcgatcaagggggaggacagcctccaaaacatgagctc
ctttctcttattgaaagattttggggtacgatggacaactttttaaaaaaattaatcgaa
gttgctgcaggagttcaaggctccggttgggcctggctaggattttgtcccgcaaaacaa
gaacttgtcttacaagcaacagcaaatcaggatcctctagagcctctcacagggaaactc
cctctgcttggcgtggatgtttgggagcacgcctattacctgcaatataaaaatgttcgt
atggattatttaaaagcctttcctcaaataattaattggggacatatagaaaatagattt
tctgaaataatatcatctaaataa

DBGET integrated database retrieval system