KEGG   Chlamydia pneumoniae CWL029: CPn0703Help
Entry
CPn0703           CDS       T00021                                 

Definition
(RefSeq) serine/threonine protein kinase
Organism
cpn  Chlamydia pneumoniae CWL029
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo SpoIIE Haspin_kinase Seadorna_VP7 Kinase-like DUF3989 Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 895224
NCBI-ProteinID: NP_224899
UniProt: Q9Z7K2
LinkDB All DBs
Position
complement(789682..791190)
Genome map
AA seq 502 aa AA seqDB search
MDCRGGIPLPEPQVIGGYHVKKILSKKLRSRVVHGLHPETRHSTVIKVFSPSPSFTSRSV
YNFLKEAQSLHQITHPNIVKFHRYGKWQDCLYIAMEYIEGISLREYILAQFISLPQAIDI
IFDIAQALEHLHSRNILHKDIKPENILITPQGKIKLIDFGLADWDTEIQRAHPSVIGTPY
YMSPEQRQGESHSPASDIYALGLLAYELILGHLSLGRVFLSLVPERISKILAKALQPSPN
NRYSSTREFIQDIHHYRMSGDMQEDLRIKDHTVALYEQLQTQRFWLAPETLRFPDFISGV
LYHQGYPLYPHAYDTLLEGDVFNLWLGYSPISNATIALSVVKSLVCQQDLQRPLLDRVCE
INECLIRMKIPIDEMGISILCLEISKENKELSWIACGKTVFWIKRQGRVVQDFESFSPGL
GKITSLQIRETKVAWEIGDEAVVCTLELEESVASLKTLSLAELQDRRQKAIFCPIESIHG
GIQSRQHGSNSPSTLISLKRIR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcgtggtggcatccctcttcctgaacctcaggtgattggcggatatcatgtt
aaaaaaatattgagtaaaaaattaagaagtagagttgttcatggtctacatcctgaaaca
cgccattctacagtcataaaagttttttctccttccccctcgttcacgagtcgctctgtc
tataattttcttaaggaagcacagagcctccatcaaattactcatcctaatattgttaag
ttccatcgctatggcaaatggcaagattgcctctacattgctatggagtatatagaaggg
atctctttaagagagtatatcctcgcgcaatttatctctttgccacaagccatagatatt
atctttgatattgctcaagctttggagcacctccatagtcggaatattctacataaagat
atcaagcctgaaaatattctcatcactcctcagggtaaaatcaaactcatagatttcgga
ctcgctgattgggatacggaaatacagagagcacatcctagcgttatcggaactccttat
tatatgagtccagaacaacgccaaggggagtctcattctcccgcttcggatatttatgct
ttaggtttgttagcttatgagttgatcttagggcacctttctttaggacgcgtctttctt
tcattagtgcccgaaagaataagtaaaattttagcaaaagcgttacagccttctcctaat
aatcgctacagctcgacccgagagtttatccaggatatacatcactatcgcatgtctgga
gacatgcaagaagatctacgtattaaagatcacacggtagctctctatgaacagctgcaa
acacaacgattttggttagccccagaaactctgaggtttccagattttatatccggagtt
ctctatcatcaaggatatcccttgtatcctcatgcatatgatacgttgcttgaaggagat
gtttttaatctgtggttaggttacagtcctataagtaatgcaactatagctttgtctgtt
gtaaaaagtttagtctgccaacaagatctacagcgacctcttttagatagagtatgcgaa
atcaatgagtgcttgattcgcatgaaaatacccatagatgaaatgggtatctctatactc
tgcctcgaaatttcgaaagaaaataaggaactctcttggatagcttgtgggaaaaccgtt
ttctggataaaaagacagggaagggttgtccaagactttgagagcttttccccaggatta
gggaaaattacttctttacaaattcgagaaaccaaggttgcatgggaaataggtgatgaa
gctgtagtgtgtacgctggaattagaagaatctgttgcatccttaaaaaccctatcactc
gcagagttgcaagatagaaggcaaaaagctatattctgtcccatagagagcatacatggt
ggaatacaaagtcgtcagcacggaagtaactctccctcaacgctcattagcttaaaaaga
atccggtga

DBGET integrated database retrieval system