KEGG   Coprothermobacter proteolyticus: COPRO5265_0137Help
Entry
COPRO5265_0137    CDS       T00773                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00030  Pentose phosphate pathway
cpo01100  Metabolic pathways
cpo01120  Microbial metabolism in diverse environments
cpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COPRO5265_0137
Enzymes [BR:cpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     COPRO5265_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACI17757
UniProt: B5Y6W0
LinkDB All DBs
Position
135246..137045
Genome map
AA seq 599 aa AA seqDB search
MGYAGKLLRVNLSTGEIKTEQLDFALSRMFLGGRGLASKILYDEIDPKVDPLSPENKIIF
AAGPLTGTNAPTGGRYMVITKGPLTGTIASSNSGGFFGAELKFAGYDMVIFEGKSDKPVY
LSIHDEEVQLKDATQLWGKDVFETTDILANEFGDGKARVSCIGPAGENLVKFAGVMNDKH
RAAGRTGVGAVMGSKNLKAIVVRGSGRPKPSSPDFMEVVRQKINIIKQNPVTGEGLPALG
TKVLDNIINQSGAYPTRNFQESVFERTHEVSGEALVEKKYLKKNTACFACPIGCGRVITL
PNGIDSEGPEYEAGWAYGADCGVDDLIAICEANHLCNKYGIDPISAGSTIACAMELYEKG
YLPKEDLNKGPEPIFGSSEAIVYYTKAIAFREGLGDKLAEGSKRLSEMYGHPEFAMHVKG
QELPAYDPRGVQGHGLQYATSNRGGCHVRGYMISPEVLGIPEKLDPQELNGKPEWVKTFQ
DLTAVIDSAGLCLFTSFALTADDYRDLVNADTGFNYTTEELMKVGERVWNLERLFNLKAG
FTKADDTLPKRLLEQPVAEGPNKGAVHHLSELLPLYYQARGWNEDGVPTPEKLSELGLE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgctgggaagctactcagggttaacctgagcacaggggaaataaaaaccgag
caactggacttcgctttatcgcgcatgtttcttgggggcagaggtttggcaagcaagata
ctttacgatgaaattgaccccaaggtagatccactttctccagaaaataagatcattttt
gctgcaggtccactcactgggacaaatgctcccacaggcggacgttatatggttattact
aaggggccacttactggtaccatagctagcagcaactctgggggtttcttcggagctgag
ttgaagtttgcaggctacgacatggtcatatttgaaggtaaatctgataagccagtttac
ctttccatacatgatgaagaggttcaacttaaggatgcaacacagttgtggggcaaggat
gtatttgagaccacagacatactggcaaatgagtttggtgatggtaaagctcgcgtttca
tgcattggccctgccggtgaaaacttggttaaatttgcgggtgttatgaacgataagcac
cgtgctgctggtagaacaggcgttggggctgtcatgggaagcaagaacctaaaagccatt
gtggtaagaggcagtggaaggccaaaaccaagtagccctgattttatggaggtagtaaga
caaaaaatcaatatcataaaacaaaatcccgtaactggagaaggtttaccagcactgggt
actaaagtacttgacaacattatcaaccaatcaggtgcataccccacaagaaatttccag
gaatcggtttttgagagaactcatgaagtgtctggagaagctttggtggaaaagaagtac
ctgaaaaagaatacggcatgcttcgcctgccccatcggttgcggtcgtgtcataactctg
ccaaacggtattgactctgaaggacctgaatatgaagcaggctgggcctatggtgcagat
tgcggtgttgatgatctgatcgccatctgtgaggcaaatcatctttgcaataagtacggc
attgatcccatatctgctggttctaccattgcctgtgccatggagctttatgagaaaggt
tatctgcccaaagaagaccttaacaaagggcctgagcccatattcggtagctctgaagcc
attgtgtactatacaaaagccatagcttttagggaagggctaggggacaagctggctgag
ggtagcaaacgactttcagaaatgtacggacatcctgaatttgctatgcacgtaaaggga
caggaactacctgcttacgatccaagaggtgttcaaggacacggtcttcagtacgctaca
agtaaccgtggtggatgccacgtcagaggttacatgatctctcccgaagtcttgggtatt
cctgaaaagttggatcctcaggagctcaacggcaagccagaatgggtaaagaccttccaa
gatttgactgcggtcattgattctgcgggattgtgtctgtttacctcgtttgcacttaca
gctgatgattacagggaccttgtaaatgctgatacgggttttaactacaccacagaagaa
ctaatgaaagttggcgaacgggtttggaacttagagcgtttgtttaacttgaaggccgga
tttaccaaagctgacgatacactaccgaaacggcttcttgagcagcctgtggcagaagga
cccaataaaggagctgtgcatcacctgtctgaactgctaccactttattaccaagcgcgt
ggctggaatgaagatggcgttcccacgccggagaaactaagcgagcttggtctggagtag

DBGET integrated database retrieval system