KEGG   Coprothermobacter proteolyticus: COPRO5265_1341Help
Entry
COPRO5265_1341    CDS       T00773                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00500  Starch and sucrose metabolism
cpo01100  Metabolic pathways
cpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COPRO5265_1341
Enzymes [BR:cpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     COPRO5265_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ACI17870
UniProt: B5YA45
LinkDB All DBs
Position
1205615..1208086
Genome map
AA seq 823 aa AA seqDB search
MEKKLPENLKDLAAVAYNFWHTWSRSAMKLWSKIDPDLWKAYQNPVKLLLETPSERLEEL
SKDEDFLSLYELVTERFHSYMKESNTWFNANYPNWDTKFVYMCMEYGISEALPIYSGGLG
ILAGDHLKSASDLGIPLIAVGLLYKHGYFVQEISSDLTQQELFPQYSPEDLPITPLLDAE
GKPVLVQVPLDDQMITARVFQADVGRVKLYLLDPDTPETPPEYRLICDYLYNPGMDIRVA
QEILLGVGGIRLLKELNIEPGLVHLNEGHPAFAAFERIKDLMQKGLSFEESLEVVKESTV
FTTHTPVPAGHDKFPVDFIYGRFRSFFEGLPADKFLSLGKETEDSGELNMTVLAIRTSAY
VNGVSQLHARVSREMFRNLWKGYTLEEVPIEGITNGVHTLTWICSEFSRIYDRALSRVWR
EHTDLEGMWYGVERISDADLWEAHLKAKKNFISLMKEKIQSRNKRLNLSDPLPEIDENSL
IIGFGRRFATYKRAILIFRDLERLKKILNTPGRPVYLVFAGKAHPNDGPGKEFLSQVLRM
TKEPGFAGKVFFLENYDISLARAMVSGVDVWLNTPRRPQEASGTSGMKAAINGVLNLSIY
DGWWVEGYNGKNGWVVGDESLEPEHEENDQRDSESLYNILETQIIPTYYENRTKWLSMMR
ESIKSIVPRFSTHRMVKEYMDKTYVKAFINSERLSKNDFENAKRDVNWESRVVEAWNGVS
VKNVAVEENGASLRVTVNLGQLSPEDVKVELFLGREGTELEKVRTVELRRYVSEGDSTFT
YFYTDGFLRHLGNPCWKYFVRILPDTSDTDIIQHVPIIWYVIQ
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
attgaaaaaaagttgccagaaaatcttaaagacctggcagctgtagcatataacttttgg
cacacgtggtcacgttctgccatgaaactttggagcaaaatagaccctgatctctggaag
gcttaccaaaaccctgttaagctccttttagaaacacccagcgaaaggcttgaagagctt
tcaaaagacgaagactttttgtccctgtatgaattggtcacagaaagattccacagttac
atgaaggagagcaacacatggttcaatgctaattaccccaactgggacacaaagtttgtt
tacatgtgcatggaatatggaataagtgaagcactgcccatttattcagggggcttaggt
attcttgctggcgaccacctaaagtctgctagcgatttaggaataccactaattgccgtt
gggcttctgtacaaacacggttattttgtgcaagaaatcagctccgatcttacgcaacaa
gaattgtttcctcaatacagtccggaagacttacccattacacctttgcttgatgcagaa
ggcaaacctgtattagtccaagtccctctggatgaccaaatgattacagccagagttttt
caagctgacgtaggacgcgttaagctttaccttttagatccagatacaccagaaactcct
cctgagtacaggcttatatgtgattacctctacaatccgggtatggacatacgagttgca
caagaaatactgctgggtgtagggggcataagacttctcaaagagctgaatatagaaccc
ggattagttcatcttaatgaagggcatccagcatttgcagcttttgaacgcataaaagac
cttatgcagaagggcttgtcttttgaggaatcactggaagtggtcaaggaaagtaccgtt
tttaccacccacacacctgtaccagctggtcatgataagtttccagtggactttatctat
ggtcgttttaggtcattttttgaaggtttgccagcggataaatttctaagtttgggcaaa
gaaacagaagattctggtgagctgaacatgacagttttggccatacgcacttccgcctac
gtcaatggtgtgagtcagttgcatgcacgtgtgtccagagaaatgttccgcaatctttgg
aaaggttacacgttggaagaagtacccatagagggcattacgaacggagtccatacatta
acatggatttgctcagagttttccagaatctatgaccgtgcactcagcagggtatggcgt
gaacacacagatttagaaggcatgtggtacggcgttgaacgtatttcggacgccgatttg
tgggaagcgcatttaaaagcaaaaaagaactttatatcgctcatgaaggagaaaattcag
agtagaaacaagcgccttaatctgagtgatccgttacccgaaattgatgaaaatagcctc
ataataggttttggcagacgttttgctacttacaaacgcgccattttgattttccgtgat
ttggaaagactcaagaaaatcctgaacacaccaggccgaccggtttatctggtatttgca
ggtaaagctcatccaaacgatgggccaggcaaagaatttcttagccaagttcttcggatg
acaaaggaaccaggattcgccggcaaagtgttcttcttagaaaactacgacatttcttta
gccagagccatggtatcaggcgttgacgtttggctcaacacgccacgacgtccacaagaa
gctagtggcaccagtggcatgaaagcagccataaacggtgttttaaaccttagtatttac
gatggatggtgggtagaaggttacaacggcaagaacggatgggttgtgggagatgaatct
ttggaacctgagcacgaagagaatgatcaaagggactcagaaagcctgtacaacatactc
gaaactcaaataatcccaacctattatgaaaacagaaccaaatggctttcaatgatgcgt
gagagtattaagagcattgttccgcgcttcagtacacatcgcatggtcaaggagtacatg
gacaaaacatatgtaaaagcttttatcaattcggaacgtctctccaagaatgattttgag
aatgctaagcgcgacgttaattgggaaagtagagtcgttgaagcgtggaacggtgtttca
gtaaagaacgttgctgtggaagaaaacggagcaagcttacgagtcaccgttaatttgggg
caactttcccctgaagatgtcaaagttgaactttttttaggcagagaaggtacagaacta
gagaaagtacgaaccgttgaactgcgcagatatgtatcagaaggtgacagcacttttact
tacttttacaccgatggtttcttgcgacaccttggtaacccttgctggaagtactttgtt
agaatcctgcctgacacttctgacacagacataattcagcacgtacctataatctggtac
gtcatccagtag

DBGET integrated database retrieval system