KEGG   Cloacibacillus porcorum: BED41_13890Help
Entry
BED41_13890       CDS       T04453                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpor  Cloacibacillus porcorum
Pathway
cpor00250  Alanine, aspartate and glutamate metabolism
cpor00410  beta-Alanine metabolism
cpor00430  Taurine and hypotaurine metabolism
cpor00650  Butanoate metabolism
cpor01100  Metabolic pathways
cpor01110  Biosynthesis of secondary metabolites
cpor01120  Microbial metabolism in diverse environments
cpor02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BED41_13890
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BED41_13890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BED41_13890
   00430 Taurine and hypotaurine metabolism
    BED41_13890
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BED41_13890
Enzymes [BR:cpor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BED41_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANZ46092
UniProt: A0A1B2I7Z4
LinkDB All DBs
Position
3088305..3089696
Genome map
AA seq 463 aa AA seqDB search
MSLYQKEYEHRAIDPTFGSAAMSSLLPKDAFPEAEMNPQDAYQAIHNELVLDGNASQNLA
TFCQTWLDDETHKLMDECIDKNMIDKDEYPQTAELEARCVRMLGNLWNSPEEANTIGTST
TGSSEAAMLGGLAALWRWRKKRKAQGKPTDKPNIVTGAVQICWDKFARYWDIEQRQIPMK
PGKYCMTPEEVVKYVDENTICVVPTLGLTFTLQYEPVKQIAAALDKLQQETGLDIPIHVD
GASGGFIAPFIHRDLVWDFRIERVKSINASGHKFGLSPLGVGWVMWREVSDLPEELIFYV
NYLGGNMPTFALNFSRPAGQIVSQYYNFIRLGKEGYTKIQQECAETGQYLANEIMKFGIF
EMVYDGEGGVPGCTWKFRDDVKPGFSLYDLADKLRSRGWQVPAYSLPADAQNIVVQRILV
RKGFNIDMASLLVEDMKRALEYFKAHPVAKPLTEAETGNFKHS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcactttaccagaaggaatatgaacacagagccattgacccgacattcggctcagcg
gcaatgagcagcctgctgcccaaggacgcgttcccagaggcggagatgaatccgcaggat
gcctatcaggcgatccataacgaactcgtactcgacggcaacgcttcacagaaccttgcc
acattctgccagacctggctcgacgacgagacccataagctcatggacgaatgtatcgac
aagaacatgatcgacaaggacgaatatcctcagacggccgaacttgaggcgcgctgcgtc
cgtatgctcggcaacctttggaattcaccggaagaggccaacaccatcggcacctcgacg
accggatcatccgaggcggcaatgctcggcggactcgcggcgctctggcgctggcgcaag
aagcgcaaggcgcagggaaaacccacggacaagccgaacatcgtcaccggcgcggtacag
atctgctgggataagttcgcccgctactgggatatcgaacagcgccagatcccaatgaag
cccggcaaatactgcatgacgccggaagaggtagtcaagtatgtcgacgaaaacaccatc
tgcgtcgtccccacgctcggactgaccttcacgctccagtacgaaccggtcaaacagata
gcggcggctctcgacaagctccagcaggagaccggacttgatatccccatccacgttgac
ggcgcgagcggcggcttcatcgcccccttcatccaccgcgacctggtctgggacttccgc
attgagcgtgtaaaatcgatcaacgcctccggacacaaatttggtctgtcgcccctcggt
gtgggctgggtaatgtggagagaggtgtccgacctccccgaagagctcatcttctatgtc
aactaccttggcggcaacatgccgaccttcgccctcaacttctcacgccccgcgggacag
atcgtcagccagtattacaacttcatccgcctcggcaaagagggctacacgaagattcag
caggaatgcgccgagaccggccagtatctcgcgaacgagatcatgaagttcggcatcttc
gagatggtctatgacggagagggcggcgttcccggctgtacttggaaattccgcgacgac
gtgaaacccggattctcgctctacgacctcgccgacaagctccgctcaaggggctggcag
gttcccgcctattcgctcccagcggacgcgcagaacatcgtcgttcagcgtatcctcgtc
aggaagggcttcaacatcgatatggcctcgctcctcgtcgaagatatgaagagggcgctt
gaatatttcaaggctcatcccgtcgcaaaacctcttacggaagctgagaccggaaacttt
aaacactcataa

DBGET integrated database retrieval system