KEGG   Citrobacter portucalensis: FOB25_08215
Entry
FOB25_08215       CDS       T06238                                 

Definition
(GenBank) lytic transglycosylase domain-containing protein
Organism
cpot  Citrobacter portucalensis
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: QET56422
LinkDB
Position
1736653..1737186
AA seq 177 aa
MASRLCTLTVGLLISAHACAVPPLYAQIARQQQVPAELLYAVARAESGTRLAQGLHPWPW
TLNIAGTGYRYPSRSSACQALLAFARTRSLKRIDAGLGQINLGWNGQRFPSLCASFDPAD
NLTVTALLLRQHYNASPGSWLDAAAHYHHPAGGKPAAVYRQKISQQIRLLSASGMSP
NT seq 534 nt   +upstreamnt  +downstreamnt
atggcatcccgtctctgcaccctgacagtcggcctgcttatcagcgctcacgcctgtgcc
gtgccaccgctatatgcgcaaatcgcccgtcaacaacaggttccggcggaactgctctac
gcggtggcccgcgcggaaagcggcacccggctggcgcaggggctacatccgtggccgtgg
acgctgaatattgccggaacaggataccgttaccccagccgttcttcagcctgccaggca
ttactggccttcgcccgcacccgcagcctgaaacgcatcgatgccgggctgggacagatt
aacctcggctggaacggccagcggtttccctcactgtgcgccagctttgatccagctgat
aatcttaccgtcacagccctgctgctgcgtcagcactacaacgcatctcccggaagctgg
ctggacgccgccgcacactaccaccatcccgccggaggcaaacccgccgccgtctaccgc
cagaagatcagccagcaaatccgattactctccgcatcagggatgtcaccatga

DBGET integrated database retrieval system