KEGG   Citrobacter portucalensis: FOB25_08235
Entry
FOB25_08235       CDS       T06238                                 

Definition
(GenBank) TIGR03747 family integrating conjugative element membrane protein
Organism
cpot  Citrobacter portucalensis
SSDB
Motif
Pfam: DUF4400 DUF5324
Other DBs
NCBI-ProteinID: QET56426
LinkDB
Position
1739849..1740532
AA seq 227 aa
MPEHAPPGPVRRPALLGWLALLPGVLAGFCLGAWMLAIALEWLGDAFFWRNTCASHSEQV
LQATWQWWRGSAGAPMWLVEDPAIVSDTLQKGISTLVHSLNGQSGLFWTEAVTTVIRCAL
LSSENITLTFLLRLAILLQALPLFALTITIGLIDGLVRRDLRRFGAGHESGFVYHHARRM
ISSSLAATGLVWLTVPVFLDPVYLLVAGAILIGLTISVAVGAFKKFM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgcccgaacatgcgccaccaggccccgtgcgtcgccccgcactgctcggctggctcgca
ttgttgcccggcgtgctggctggcttttgcctcggtgcatggatgctggcaatagcgctg
gagtggctgggcgacgcatttttctggcggaacacctgcgccagccacagtgaacaggta
ttgcaggcgacatggcagtggtggcggggttccgctggcgcaccgatgtggttagtagaa
gaccccgcgattgtcagcgatacgttgcagaaaggtatatcgacgctggttcattcgctc
aacggacaaagcggattgttctggacagaggctgtcaccacggtgatccgctgcgcattg
ctgtcttcggaaaatatcaccctcacctttctgttgcggctggcgattctgttgcaggcg
ctaccgctgtttgcgctcaccattaccattggccttatcgacgggctggtaagacgcgat
ttacggcgattcggcgcaggccatgagtccgggtttgtttatcatcacgccaggcgtatg
atcagctccagccttgcggcaacggggctggtgtggctgacggtgccggttttccttgat
ccggtgtatttgttggtagcaggagcaatactaatcggcctaacaatatcagtggcagtt
ggggctttcaaaaaatttatgtga

DBGET integrated database retrieval system