KEGG   Citrobacter portucalensis: FOB25_14240
Entry
FOB25_14240       CDS       T06238                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cpot  Citrobacter portucalensis
Pathway
cpot00052  Galactose metabolism
cpot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FOB25_14240 (gatD)
Enzymes [BR:cpot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     FOB25_14240 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_31 UDPG_MGDP_dh_N 2-Hacid_dh_C Methyltransf_25 TrkA_N MTS 3HCDH_N Methyltransf_24 ELFV_dehydrog Methyltransf_11 PrmA Peptidase_U32 Shikimate_DH Methyltransf_12 Fer4_4
Other DBs
NCBI-ProteinID: QET57518
LinkDB
Position
complement(2985453..2986496)
AA seq 347 aa
MKSVVIHAEGDVRVEERPIPQLQTDEDVLVKVVSSGLCGSDIPRIFNHGAHYYPITLGHE
FSGYVESYGASVTDLQPGDAVACVPLLPCFHCPQCERGYFSLCKHYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIDDGAFIEPITVGLHAFHLAQGCEGKNVSIVGAGTIGLLAMQCA
RELGAKSITAIDINPQKLALAKELGATHVFNSREMSAAEIHAGLENIQFDQLVLETAGTP
QTVTLSIEIAGPRAQLALVGTLHHDLTLASGVFGQILRKELTILGSWMNYSSPWPGEEWE
TAARLLTEKRLQLEPLIAHTGNAESFASAVKSLHGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggcgacgtacgcgttgaagaacgtcccatacca
caactgcaaactgatgaagatgtattggtcaaagtggtcagttcagggctttgcggctca
gacattccccgtatcttcaatcatggtgcgcactattatccaatcacgctcgggcatgag
ttcagtggttatgttgagtcctacggcgcaagcgtaaccgacttacaacccggtgatgcc
gtggcctgcgtaccgctgcttccctgctttcattgccctcagtgcgagcggggatacttc
tcgttatgtaaacattatcagtttgtcggttcacgaagcgaaggtgggaacgcagaatat
gtggttgtaaaacgcgccaacctgttccgcctgccttcagatatgccgattgatgatggc
gcattcattgaaccgattaccgtcggtctgcatgcttttcatctggctcagggatgcgaa
ggcaaaaatgtgagtatcgttggtgctggtactatcggtttgctggcaatgcaatgtgcc
cgtgaactcggtgccaaaagtatcacggcaattgatatcaatccgcaaaagctggcatta
gcaaaagaactgggggcaacccatgtgtttaatagtcgggagatgagtgcggctgagatc
cacgcaggcctggaaaatattcagtttgaccaactcgtgctggaaacagcgggaaccccg
caaactgtgacgctgtcgattgagattgcaggccctcgtgctcaactagcgttagtcggc
acgttacatcacgatctgacgcttgcttcaggtgtctttgggcaaatattacgtaaagaa
ttaaccattcttggcagttggatgaactattccagcccatggcctggagaagagtgggaa
accgctgcccgtttattgacggaaaaacgcttacagcttgagccattaattgctcacact
ggcaatgccgaaagctttgccagcgccgtcaagtcactccacggcgcgccgatgcaagga
aaaattctactcaaactatcctga

DBGET integrated database retrieval system