KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1228Help
Entry
CpP54B96_1228     CDS       T01771                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00010  Glycolysis / Gluconeogenesis
cpp00520  Amino sugar and nucleotide sugar metabolism
cpp01100  Metabolic pathways
cpp01110  Biosynthesis of secondary metabolites
cpp01120  Microbial metabolism in diverse environments
cpp01130  Biosynthesis of antibiotics
cpp01200  Carbon metabolism
Module
cpp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpP54B96_1228 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CpP54B96_1228 (ppgK)
Enzymes [BR:cpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CpP54B96_1228 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFF22364
LinkDB All DBs
Position
1319334..1320086
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRIVAEAEWEG
PVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAAGIAEVAFG
EDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAAKDRDELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggcggatctgggattaaaggtgcccgcgtt
gatctggataccggtgattttgtcggagatcggatcaaaattttaacccccaagcctgcc
acccccgaagcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaagga
cccgtcggaataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaac
attgaccaatcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcggg
cgtaacatcgcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcgga
gaagatcaagctcgacgtggttccgccattttgctcactctaggcactgggatcggttcc
gctttctttatcaacggggtcttattccccaacaccgagttagggcacatgatcgtagag
ggaaaggaagccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctat
tccaaatgggccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggcca
gacgtttttatcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactc
actatcgatacgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagca
gcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system