KEGG   Corynebacterium pseudotuberculosis C231: CpC231_1102Help
Entry
CpC231_1102       CDS       T01877                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00620  Pyruvate metabolism
cpq00680  Methane metabolism
cpq01100  Metabolic pathways
cpq01120  Microbial metabolism in diverse environments
cpq01200  Carbon metabolism
Module
cpq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CpC231_1102 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CpC231_1102 (ppc)
Enzymes [BR:cpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CpC231_1102 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADL10578
UniProt: D9QAK2
LinkDB All DBs
Position
complement(1204775..1207456)
Genome map
AA seq 893 aa AA seqDB search
MSVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGIAAFDRVEAARQLAFKISRKESQVE
DLVALLKDISAADAIPIIRAFSHFALLANMVEDLHDELGRLQRQEAGEQDPDSTLGATWK
KLANAGITNEKVSSLLSNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKKRHAILSSETN
ALTTARLEENTRHIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYELSLLTAIPEINKQV
ADHIQREYGVNSEDALQSLLIKPGSWIGGDHDGNPYVTAGTLHYATTRAAETVLKFYVHG
VRGRVLATLASRIGPETVEGSWYSRHAAYTAPEQLAADLDIIDASLRRTHDELIADDRLL
RIRTAVSSFGFHLYSMDLRQNSESYEDVLTELFERAQVTPHYRKLDESEKISVLIAELSS
PRPLIPRDGLPYSELTQRELDIIFEAKQAVDAFGTMMIPHSIISMAESASDILEPMVLLK
EFGLIKIQEGHLTGHIDVIPLFETIDDLQNGAKILQDLWQIPLYRSYLEQRGNLQEVMLG
YSDSNKDGGYLAANWALYAAETDLVNICKQHGIALRLFHGRGGTVGRGGGPSYEAILAQP
HGAVQGSVRVTEQGEIISAKYGSAGAARRNLEALASATLEASLLKIDQVEEQYPEAYEIM
GEISRLSQKKYSRLAHEDPGFIEYFTSSTPLEEIGELNIGSRPSSRKQTKSIDDLRAIPW
VLSWSQSRVMLPGWYGVGSALHEWIEKGCAQTAELSPDERLVVLQELNSSWPFFSSVLSN
MAQVMSKAEMQLAKLYSGLVADQEAANRIFSDISAEFELTKKMFLKITGFSGLLDDNPML
ARSVRSRYPYLLPLNTLQLEMLRRYRKGDDDPKVVHGIRLAMNGLATALRNSG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagctacgtctgcgggtccactatccgaacaacttgttgaggacatacgc
tttctcggtgctcttttaggggaggtgatcaaggaacaagaaggaatagcagcctttgac
cgggtggaggcagcaagacagctggcttttaagatttctcgtaaggaatcacaggttgaa
gacttagtggcattgctaaaggatatttcagcagcagatgcgataccaatcattagagca
tttagtcatttcgcgctactcgcaaacatggtggaggacttgcacgatgagttgggcaga
cttcagcgacaggaagccggtgaacaagatccagattcaactttaggcgccacatggaaa
aagctggcgaatgctggcataacaaatgaaaaagtttccagtttgctgagtaattttcaa
gtggctccagtgcttactgctcaccctacggaaacccgtagacgcacgatcttcgatgct
caagagcatatgactactctgcttaaaaagcgtcatgcgattcttagctctgagacaaat
gcgctgacaactgcacggcttgaagaaaatactcgtcatattcgtaggtggctgacctta
atatggcaaactgcgcttatccgtgtagcccgtcctcggattgaagatgaggtagaagtt
gggttgcgttattatgagctctctttactcactgcgatccctgagatcaataagcaagtg
gctgatcacatccagagagaatatggtgtgaactccgaagatgctttgcagtcactattg
attaagcccggaagctggatcggtggcgatcatgacggtaacccgtatgtcactgcagga
actctgcactacgcgacaacgcgagccgccgagactgttttaaagttttatgtccatggt
gtacgtggtcgagtacttgccacactagcttctcgaatcggcccagaaacagtagaaggc
tcatggtattcccgccatgctgcgtatactgcacctgagcaactcgcagctgatttggac
attatcgatgcttctttgcggagaactcacgatgagctcatcgcagatgatcgtctgctg
cgcatacggacagcagtatcgagctttggtttccatctttactcgatggatctgcgtcaa
aactctgagagttacgaggacgtgcttactgagctctttgagcgggcccaagtaactccg
cactatcgaaaattagatgagagcgaaaaaattagcgttttgatcgccgagctatcctcg
ccaaggcctctcattccgcgcgatggcttgccgtacagcgagttaacgcagcgggaactc
gatattatttttgaggcaaagcaagccgtggatgcctttggaacaatgatgattccacac
tctattatttcgatggcagaatctgcgagcgacattctcgagccaatggtcctactgaaa
gaatttggattaatcaagattcaagaaggccatctcacagggcatattgacgttatacct
ctttttgaaacaatcgatgacctacaaaatggtgcaaagattctccaagatttgtggcag
ataccgttgtatcgcagttatttagagcaacgaggcaatctccaggaagtgatgctcggt
tattccgattccaataaagatggtggctaccttgccgcaaactgggctttatatgcggca
gaaactgaccttgtaaacatatgtaagcaacatggtattgctctgaggcttttccacggg
cgtggtggcaccgtagggcgtggtggcggtccctcttatgaggcaattctcgctcagcca
catggtgcggtgcaaggtagcgtacgcgtcacggagcaaggcgagattatctcggcaaaa
tacggttctgcgggagctgctcgccgtaatctggaggctctggcctcagccacattggaa
gcttctttgctcaagatcgatcaagtagaagaacagtatcctgaggcctatgaaattatg
ggcgaaatttcgcggttgagtcagaaaaagtattcgcggcttgctcatgaagatcccgga
ttcattgaatatttcacgtcatcgacgcctttggaagaaataggggagctcaacatcggc
tctcgtccttcctcgagaaaacagactaagagcatcgatgatttacgcgcgattccctgg
gtgcttagttggtcgcagtcacgtgtcatgcttcccggttggtatggagtaggcagtgct
ctacatgaatggatagagaaggggtgcgcgcagacagcggaactatctccggatgaacgt
ctcgtggttctgcaagagcttaattcttcctggccattcttttcttcggtgttgtctaat
atggcgcaggtgatgagtaaggctgagatgcagctcgccaagctctactcagggctagta
gcagaccaagaagccgcaaacaggatattctccgatatctctgctgaatttgagcttact
aagaaaatgttccttaagattaccggtttttcggggcttctcgacgacaaccctatgctc
gcacgatcagttcggtcccgctatccatacttgctacctcttaatacgctgcaacttgaa
atgttacgtcggtatcgcaagggggatgatgaccctaaggtagtgcatggtattcgtctg
gctatgaacggcttggccaccgcgctgcgaaattctggttag

DBGET integrated database retrieval system