KEGG   Corynebacterium pseudotuberculosis C231: CpC231_1203Help
Entry
CpC231_1203       CDS       T01877                                 

Gene name
ppgk
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00010  Glycolysis / Gluconeogenesis
cpq00520  Amino sugar and nucleotide sugar metabolism
cpq01100  Metabolic pathways
cpq01110  Biosynthesis of secondary metabolites
cpq01120  Microbial metabolism in diverse environments
cpq01130  Biosynthesis of antibiotics
cpq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpC231_1203 (ppgk)
   00520 Amino sugar and nucleotide sugar metabolism
    CpC231_1203 (ppgk)
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CpC231_1203 (ppgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADL10678
UniProt: D9QAV2
LinkDB All DBs
Position
1319191..1319967
Genome map
AA seq 258 aa AA seqDB search
MPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRI
VAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAA
GIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAA
KDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLR
NTAGIVGAAMAADQNIRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgccattcagtaagctcaagttcatgacacgaattggctttggcattgatgttggcgga
tctgggattaaaggtgcccgcgttgatctggataccggtgattttgtcggagatcggatc
aaaattttaacccccaagcctgccacccccgaagcggtcgcccaaacgatttctcgcatt
gttgcagaggccgaatgggaaggacccgtcggaataacgctgccttccgtaatccggaat
caagtagcactttctgccgccaacattgaccaatcatggatcaatgttgatgttcaaaaa
ttatttaccaagaccctgggcgggcgtaacatcgcagtgcttaacgacgccgatgcggcg
ggcatcgccgaggtagccttcggagaagatcaagctcgacgtggttccgccattttgctc
actctaggcactgggatcggttccgctttctttatcaacggggtcttattccccaacacc
gagttagggcacatgatcgtagagggaaaggaagccgagcatctagcttcatctgcagca
aaagatcgcgatgagttgagctattccaaatgggccaagcgcgtttctaaagtcctcagc
gaatacgaacgacttttttggccagacgtttttatcgtaggcggtggtatctcacgcaaa
gctgataaatgggtacccaaactcactatcgatacgcccgtcatacctgcaaaactacgt
aataccgcaggtatcgtaggagcagcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system