KEGG   Clostridium perfringens SM101: CPR_1709Help
Entry
CPR_1709          CDS       T00379                                 

Definition
(GenBank) serine/threonine protein kinase BH2504
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpr01001]
    CPR_1709
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CPR_1709
Protein kinases [BR:cpr01001]
 Serine/threonine kinases: Other
  Bacterial family
   CPR_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like PBP1_TM APH Pkinase_fungal RIO1 ETRAMP Sigma_reg_N Fructosamin_kin Kdo DUF3899 DUF2232 Herpes_US9 YL1 NOA36 DUF4611
Motif
Other DBs
NCBI-ProteinID: ABG87813
UniProt: Q0SS83
LinkDB All DBs
Position
complement(1903635..1905710)
Genome map
AA seq 691 aa AA seqDB search
MIGKILGNRYELLQCVGEGGMSFVYKAKCRKLNRFVAVKILKDEFKNNEEIVRRFKKEAT
AIANLSNPNVVNVLDVGTQDDINYIVMEYIEGKTLKDIINEKGALPYEIAISIGIKVAKA
LECAHKSGIIHRDVKPQNILVTEEGVVKVTDFGIAKSMDSSTIAHTNSVMGSAHYFSPEQ
AKGTYTDYRTDLYSLGIVLYEMVTGVVPFNGDSPVTVAVKHIQEKAIPPKNINQNIPNSL
NDLIMKAMEKDPVNRYQTAKEIIGDLEKIKKDPNVTISSKSAEDEDQFTRVMSPVVVPNT
ETNNLEPDEDDEDDEYYEDDEDEDEEENNIQTKPQKAINKKKKKSPILIIITTILVVALG
ITLGFLGMKNFMEGGKDVKIPNVVGEKVEDAKSKLEGLGLKVLEVTEESDQEKGIVLKVD
PNVDSTVKTGSEVKLTVSGGEGKIKVPNFAEMNLDSVKKTLKNLGLELGNVDEEYSDSVP
RGEVISQSPNANESVDKGSKVNVTISKGKEIKSETINIPDVSGKSVEEAKSILSNAGVGV
NPVKGEAAKSEGEAGKVYSQSQSGSLTIKQGEKVTITINYHGDYVKPEKSVPGVTGKSVD
EAKSELTNAGFKVNAVKGEAAKSADQAGKVYSQDGGSSAKEGATITITYYDKYVEPNQKP
DGNNDGTGTGNEQGGQPSNNQHPNNDTNKKS
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaatcttagggaataggtacgaattacttcaatgtgtaggtgaaggtggt
atgtcctttgtttataaagcaaaatgtagaaaattaaatagattcgtagctgttaaaata
ctaaaagatgaatttaaaaacaatgaagaaattgttagaagatttaaaaaagaagctaca
gctattgctaacttatccaatccaaatgtagtaaatgtattagatgttggaactcaagat
gatattaattatattgttatggaatatattgaaggtaaaactttaaaagatataattaat
gaaaaaggtgctttaccttatgaaattgccataagtataggaataaaggttgctaaagct
ttagaatgtgcccataaaagtggaattatacatagagatgttaaaccacaaaatatatta
gttacagaagaaggagttgttaaagtaacggactttggaatagctaagtctatggattca
tctactatagcacacactaatagtgttatggggtctgcacattatttttcaccagagcaa
gcaaaaggaacatatactgattatagaactgacttatattctttaggaatagtattatat
gaaatggttactggagttgttccttttaatggtgattcgcctgttactgtagctgtaaaa
catatacaggagaaagcaataccacctaaaaatataaatcaaaacattcctaatagttta
aatgatttaataatgaaagctatggaaaaggatcctgttaataggtatcaaacagctaaa
gaaataataggagacttagaaaagataaagaaggatccgaatgttacaatatcatcaaaa
tctgcagaagatgaagatcaatttacaagagttatgtctccagttgttgttccaaatact
gaaactaataatttagaacctgatgaagatgacgaggatgatgaatattatgaagatgat
gaggatgaagatgaagaagaaaataatattcaaactaagcctcaaaaagctattaataaa
aagaaaaagaaatcaccgatattaattataattacaactattttggttgtagcattagga
ataactcttggattccttggtatgaagaattttatggaaggtggaaaagatgttaaaata
cctaatgttgtaggagaaaaagtagaagatgctaagagtaagttagaaggattaggatta
aaggtattagaagttacagaagaaagtgatcaagaaaaaggaatagttttaaaagttgat
ccaaatgtagattctactgtaaagaccggtagcgaagtaaaacttactgttagtggtgga
gaaggtaaaataaaggttccaaactttgcagaaatgaatttagatagtgtaaagaaaaca
ttaaaaaatctaggtctagagcttggtaacgttgatgaagaatatagtgatagtgttcct
agaggggaagttatttctcaaagtcctaatgctaatgagtctgtagataaaggttctaaa
gtaaatgttactataagtaaaggaaaagaaataaaatcagaaactataaatataccagat
gtatcaggaaaaagtgtagaggaagctaaatcaatattatctaatgctggtgttggagta
aatcctgttaaaggtgaggcagctaaaagtgaaggagaagcaggtaaggtttatagtcaa
agtcaatctggatctcttacaattaagcaaggggaaaaggtaactataacaattaattac
cacggtgattatgtgaagcctgaaaaatcagttccaggagtaactggtaaatctgtagat
gaggctaaatcagagttaactaatgcgggctttaaagtaaatgctgtaaaaggtgaagcg
gctaaaagtgcagatcaagctggaaaggtatatagtcaagatggtggatcaagtgctaaa
gaaggtgcaactataacaataacttattatgataaatatgttgagccaaatcaaaagcca
gatggaaataatgatggtactggaactggtaatgaacaaggcggtcaaccttcaaataat
caacatccgaataatgatactaataaaaaatcataa

DBGET integrated database retrieval system