KEGG   Clostridium perfringens SM101: CPR_2029Help
Entry
CPR_2029          CDS       T00379                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00250  Alanine, aspartate and glutamate metabolism
cpr00410  beta-Alanine metabolism
cpr00430  Taurine and hypotaurine metabolism
cpr00650  Butanoate metabolism
cpr01100  Metabolic pathways
cpr01110  Biosynthesis of secondary metabolites
cpr01120  Microbial metabolism in diverse environments
cpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CPR_2029
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPR_2029
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPR_2029
   00430 Taurine and hypotaurine metabolism
    CPR_2029
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CPR_2029
Enzymes [BR:cpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CPR_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABG85385
UniProt: Q0SRB9
LinkDB All DBs
Position
complement(2237164..2238564)
Genome map
AA seq 466 aa AA seqDB search
MLFGKNELGSQFETPIFGTVESNEPIPKYKLAKKSIAPQVAYRLIKDDLLDEGNARQNLA
TFCQTYMDDEAVKLMSETLEKNAIDKSEYPQTTDMENRCVNILADLWHAPKELNYMGTST
VGSSEACMLGGMAMKFRWRNRAKALGMDVTSKKPNLVISSGYQVCWEKFCVYWDIEMRLV
PMDEQHMSINVDKVLDYVDDYTIGVVGILGITYTGKYDDIKALDKKLEEYNKTAKITVPI
HVDGASGAMFAPFIEPDLKWDFQLKNVVSISTSGHKYGLVYPGIGWVLWKDKEYLPQELV
FEVSYLGGKMPTMAINFSRSASQILGQYYNFLRYGFEGYRQIHQRTKDVAMYLSSELEKT
GLFEIYNNGENLPIVCYKLKDDVKVNWTLYDLADRLLMKGWQVPAYPLPEDLQNVIIQRF
VCRADLSRNLADLLMRDLKAAIEDLNNARILSKTQVDNKGVQGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgctttttggaaaaaatgaattaggtagtcaatttgaaacacctatatttggaacagtt
gaaagtaatgaacctattccaaaatataaattagcaaaaaaatcaattgcaccacaagtt
gcatatagattaataaaagatgatttactagatgaaggtaatgcacgtcaaaacttagca
acattttgtcaaacatatatggatgatgaagcagtaaaattaatgtcagagacattagag
aaaaatgctatagataaatcagaatatccacaaacaacagatatggaaaaccgttgtgta
aatatattagctgatttatggcatgctccaaaagaattaaattatatgggaacttcaaca
gttggatcatcagaagcttgtatgcttggtggtatggctatgaaatttagatggagaaat
agagcaaaagctttaggtatggatgttacatctaaaaaaccaaacttagtaatctcttca
ggataccaagtatgttgggaaaaattctgtgtttattgggatatagaaatgagattagtt
ccaatggatgaacaacatatgagtataaatgtagataaagttttagactatgttgatgat
tatacaataggtgtagttggaatactaggaattacttacactggtaaatatgacgatata
aaagctttagataaaaaattagaagaatacaataaaacagcaaaaataacagttccaata
catgttgatggtgcttcaggagctatgtttgctccatttatagaacctgatttaaaatgg
gacttccaattaaaaaatgttgtttcaattagtacatcaggtcataaatatggattagtt
tatccaggtataggttgggtattatggaaagataaagaatacttacctcaagaattagta
tttgaagtaagctatttaggtggaaaaatgcctacaatggcaataaacttctcaagatca
gctagccaaattcttggtcaatactataacttcttaagatacggatttgaaggttataga
caaatacatcaaagaacaaaagatgtagctatgtacttatcaagtgaacttgaaaaaact
ggtttatttgaaatatataataatggtgaaaacttaccaatagtttgctacaaattaaaa
gatgatgttaaagtaaactggacattatatgatttagcagatagattattaatgaaagga
tggcaagtacctgcttatccattaccagaagatttacaaaatgtaataattcaaagattt
gtatgtcgtgcagatttaagtagaaacttagctgatttattaatgagagatttaaaagca
gctatagaagatttaaataatgcaagaattttaagcaaaactcaagtagataataaggga
gtacaaggatttactcactag

DBGET integrated database retrieval system