KEGG   Collimonas pratensis: CPter91_0877Help
Entry
CPter91_0877      CDS       T04306                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cpra  Collimonas pratensis
Pathway
cpra00330  Arginine and proline metabolism
cpra01100  Metabolic pathways
cpra01110  Biosynthesis of secondary metabolites
cpra01130  Biosynthesis of antibiotics
cpra01230  Biosynthesis of amino acids
Module
cpra_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CPter91_0877 (proC)
Enzymes [BR:cpra01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CPter91_0877 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 GFO_IDH_MocA ApbA Shikimate_DH PDH Sacchrp_dh_NADP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AMP03265
UniProt: A0A127Q090
LinkDB All DBs
Position
906926..907750
Genome map
AA seq 274 aa AA seqDB search
MKKQLNISFIGGGNMAAALIGGLAGKVTDGGNIHVIDPNLEALQSLAQRFGVTPASEIDA
MVSVSDVIVLAVKPQQMKQVIGQLRPYLTTQMVLSIAAGIRAADMSRWLGGHDVIVRCMP
NTPALIGKGITGMVAGAGVSPQQRETADLIMQAVGSTVWLDDEAKIDAVTAVSGSGPAYV
FYFIEAMQQAAQELGLTAEQGIELAKATFTGAAQLAAQSAEPVSLLRERVTSKGGTTYAA
LTSMEDAGVKQAIVNAVKAAAARGQELGDEFGRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaattgaacatcagtttcatcggcggcggcaatatggcggctgcactcatc
ggcgggctggcaggcaaggtcaccgacggcggcaatatccatgtcatagatcctaacctg
gaggccttgcagagcctggcgcagcgctttggcgtgacaccggccagcgagatcgacgcc
atggtcagcgtcagcgatgtcatcgtgctggcggtcaagccgcagcagatgaagcaggta
atcggccagttgcggccctatctgacgacgcaaatggtgctgtcgattgccgccggcatt
cgcgccgccgacatgtcgcgctggctgggcgggcacgatgtcatcgtgcgctgcatgccg
aacacgccagcgctgatcggcaagggcatcaccggcatggtcgccggcgccggcgtatcg
ccgcagcagcgcgagaccgccgacctgatcatgcaggcggtcggcagcacggtgtggctg
gacgacgaagcgaagatcgacgcggtgacggcggtttcaggcagcggcccggcctatgtg
ttttatttcatcgaggcgatgcagcaggcagcccaggaattggggttgaccgcggagcag
ggcatcgagctggccaaggcgacttttaccggggcggcgcagctggcggcgcaatcggct
gagccggtctcgctgctgcgcgagcgcgtgacctcgaaaggcggcaccacctacgctgcc
ttgaccagcatggaagatgccggggtcaagcaggccatcgtcaatgcagtcaaggcggca
gcggcgcgcggacaggaactgggcgacgagttcgggcgcgactga

DBGET integrated database retrieval system