KEGG   Collimonas pratensis: CPter91_1692Help
Entry
CPter91_1692      CDS       T04306                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cpra  Collimonas pratensis
Pathway
cpra00020  Citrate cycle (TCA cycle)
cpra00480  Glutathione metabolism
cpra01100  Metabolic pathways
cpra01110  Biosynthesis of secondary metabolites
cpra01120  Microbial metabolism in diverse environments
cpra01130  Biosynthesis of antibiotics
cpra01200  Carbon metabolism
cpra01210  2-Oxocarboxylic acid metabolism
cpra01230  Biosynthesis of amino acids
Module
cpra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpra_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPter91_1692
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPter91_1692
Enzymes [BR:cpra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CPter91_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AMP04065
UniProt: A0A127Q2L2
LinkDB All DBs
Position
complement(1735917..1738151)
Genome map
AA seq 744 aa AA seqDB search
MTASKSTIIYTLTDEAPLLATASFLPIIKTFAAPAGIDVVKSDISVAARILAEFSDNLKP
EQKVPDNLAELGRLTQLPETNIIKLPNISASVPQLIAAIRELQAGGYNIPDFPEDPKSDE
DKAIQKRYSKIIGSAVNPVLREGNSDRRAPAAVKRYARKHPHSMSKWSPASRTHVSHMHG
GDFYASEKCMTLAEACDVRMELVTKAGETIVLKNKVSLLAGEIIDSMFMSKKALCAFYEE
QMEDARETGVMLSLHVKATMMKVSHPIVFGHAVKIFYKDAFAKHGKLFEELGVNANNGLS
SVYEKIATLPESKRDEVIKDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
LGGKMWGADGRPKDTKAVIPESTFARIYQEMINFCKTNGAFNPTTMGTVPNVGLMAQKAE
EYGSHDKTFEVPADGVARIVKLDGTVLLEQNVEEGDIWRMCQVKDEPIRDWVKLAVNRAR
LSGMPAIFWLDEYRPHEAELIKKVRAYLKEYDLAGLDIQIMSQVRAMRYTLERVIRGKDT
ISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMFETGAGGSAPKHVKQLVEENH
LRWDSLGEFLALAVSLEDMGIKTGNSKAKILAKTLDDATGKLLDNNQSPSPRTGELDNRG
SQFYLALYWAQALAAQTEDKELQSHFALLAKTLTENEQKIAAELKDVQGQAVDIGGYFLP
DPKKMEAIMCPSATFNAALSAARV
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcaagtaaatcgaccatcatctataccctgaccgacgaggcgccgctgctggcg
accgcttctttcctgcctattatcaagactttcgccgcaccggcagggatagacgtcgtc
aagagcgacatttcggtggccgcgcggattcttgccgagttttccgacaacctcaagccc
gagcagaaagtgccggacaacctggctgaactgggccgcctgacccagctcccggaaacc
aacatcatcaagctgccgaacatcagcgcctcggtgccgcagctgatcgcggcgatccgc
gaactgcaggccggcggctataacatcccggacttcccggaagatccgaagtcggatgaa
gacaaggcgatccagaagcgctattcgaagatcatcggcagcgccgtcaacccggtcctg
cgcgaaggcaattccgaccgccgcgcgccggctgccgtaaaacgctacgcgcgcaagcac
ccgcactcgatgtccaagtggagccccgcttcgcgcacccacgtttcacacatgcacggc
ggcgatttctacgccagcgaaaaatgcatgacgctggccgaagcctgcgatgtccgcatg
gaactggtgaccaaggccggtgaaaccatcgttctcaagaacaaggtgtcgctgctggcc
ggcgaaatcatcgacagcatgttcatgagcaagaaggccctgtgcgccttctacgaagaa
cagatggaagatgcgcgcgaaaccggcgtcatgctgtcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagattttctacaaggacgct
ttcgccaagcacggcaaattgttcgaagaactgggcgtgaacgccaacaacggcctctcc
agcgtctacgaaaagatcgccaccctgccggaatccaagcgcgatgaagtgatcaaggac
ctgcacgcctgccacgaacaccgtccggaactggcgatggtcgattcggccaagggcatc
tccaacctgcacgcgccgaacgacgtcatcgtcgacgcttcgatgccggcgatgatccgc
ctgggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggcagtgatcccg
gaaagcaccttcgcccgtatttatcaagagatgatcaatttctgcaagaccaacggcgct
ttcaatccgaccaccatgggcactgtaccgaacgtcggcctgatggcgcaaaaggcggaa
gaatacggttcgcacgacaagaccttcgaagtaccggccgacggcgtggcccgtatcgtc
aagctggacggcactgtactgctggaacagaacgttgaagaaggcgacatctggcgcatg
tgccaggtcaaggacgagccgatccgcgactgggtcaagctggccgtaaaccgtgcgcgc
ctgtccggcatgccggcgattttctggctggacgagtaccgtccgcacgaagctgaactg
atcaagaaggtgcgcgcctacctgaaagaatacgacctcgccggcctcgacatccagatc
atgtcgcaggtacgcgccatgcgctacacgctggaacgcgtgatccgcggcaaggacact
atctcggttaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatggaa
ctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggcgggcggcggcatgttt
gaaaccggcgccggcggctccgcgcctaagcatgtcaagcaactggtggaagaaaatcac
ctgcgctgggattcgctgggcgagttcctggcgctggcggtttcgctggaagacatgggc
atcaagaccggcaacagcaaggccaagatcctggcgaaaaccctggacgacgccaccggc
aagctgctcgacaacaaccagtcgccatcgccacgcaccggcgagctggacaatcgcggc
agccagttctacctggccctgtactgggcgcaggcgctggcggcacagaccgaagacaag
gaactgcaatcccatttcgccctgctggccaagaccctgaccgagaacgagcaaaagatc
gccgccgaactcaaggacgtgcaaggccaagcagtggacatcggtggctacttcctgcct
gacccgaagaagatggaagcgatcatgtgcccaagcgctaccttcaatgcagcgttgagc
gccgcgcgcgtctga

DBGET integrated database retrieval system