KEGG   Collimonas pratensis: CPter91_3567Help
Entry
CPter91_3567      CDS       T04306                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpra  Collimonas pratensis
Pathway
cpra00620  Pyruvate metabolism
cpra00680  Methane metabolism
cpra01100  Metabolic pathways
cpra01120  Microbial metabolism in diverse environments
cpra01200  Carbon metabolism
Module
cpra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPter91_3567
  Energy metabolism
   00680 Methane metabolism
    CPter91_3567
Enzymes [BR:cpra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CPter91_3567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMP05888
UniProt: A0A127Q740
LinkDB All DBs
Position
3680420..3683269
Genome map
AA seq 949 aa AA seqDB search
MAKQLNSAVQVKKSPPNKDAPLKEDIRLLGRLLGDVLREQEGDAVFEVVETIRQTAVRFR
RESDPQAGADLDKLLKKLTRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRAHLLAGSAAQ
AGSVAHALSKLDDAGVSGATVRNFLKDALISPVLTAHPTEVQRKSILDAEREIARLLAER
DRPLTAKELRDNTELLRGRIATLWQTRMLRYTKLTVADEIENALSYYRITFLRELPALYD
DIEGEIATQFPTRGRSATTELAPFVQMGSWIGGDRDGNPNVNAGTMQRALTRQSTTIFDF
YLEEVHALGAELSVSTLMVSVNQELLVLAENSPDTSDHRSDEPYRRALIGIYARLASTAR
ELGATNILRQEVGAAAHYAAPQEFTQELQIIEDSLRAHHGSALIKPRLATLKRASEIFGF
HLASLDMRQSSDVHERVLTELFAQAQVEGAYDKLSEEQKIDLLLAELAKPRLLYSPYIEY
SDETVSELSILRAAGEMRQRYGARSIRNYIISHTETVSDLLEVLLLQQETGLLRPDGKNH
AASTLEVMVIPLFETIPDLRRAAAIMEQFMALPPVSRLIAKQGKLQEVMLGYSDSNKDGG
FLTSNWELYKAEIQLVRVFDRAGVKLRLFHGRGGTVGRGGGPSYQAILAQPPGTVNGQIR
LTEQGEIIASKFSNPEIGRRNLELLVAATLEASLMPNTADSKQMKKLGEFEELMDGLSER
AYQSYRNLVYETPGFTDYFFAATPIAEIAELNIGSRPASRKSTRRIEDLRAIPWGFSWGQ
CRLLLPGWYGFGSAIESWLEEGKDAKLKSQKLATLRAMYKEWPFFATLLSNMDMVLSKTD
LAVASRYAGLVTDRKLRNSIFKRIVDEHERTSSILSAITGAKDRLSGNPLLARSIKNRFA
YLDPLNHLQVELIKRHRSVTAAGRTTEERVKRGIHLSINGIAAGLRNTG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaattgaattctgctgtccaggtaaaaaaatcccctcccaacaaagatgcg
ccgctgaaggaagatatccgtctgctgggccgcttgctgggtgatgtgctgcgcgaacaa
gagggcgatgcggtatttgaagtggtcgaaaccattcgccagacggcggtgcgcttccgc
cgcgaatcggacccgcaagccggcgccgatctcgacaagctgctgaaaaagctcacgcgc
gaccagaccaattcggtggtgcgggcgttttcctatttttcccatctggccaatatcgcc
gaagaccagcaccacaaccgccgccgccgcgcccatctgctggccggttcggccgcacaa
gccggcagcgtcgcccacgccttgagcaaactggacgatgccggcgtgtccggcgccacc
gtgcgcaacttcctcaaggatgcgctgatttcgccggtgctgaccgcccatccgaccgaa
gtgcagcgcaagagcatcctcgacgccgagcgcgaaatcgcccgcctgctggccgagcgc
gaccgtccgctgaccgccaaggaactgcgtgacaacaccgaactgctgcgcggccgtatc
gccactctgtggcaaacccgcatgctgcgctacaccaagctgaccgtggccgacgaaatc
gaaaacgccctgtcctactaccgcatcaccttcctgcgcgaactgccggccctgtacgac
gacatcgaaggcgaaatcgccacccagttcccgacccgcggccgcagcgccaccactgaa
ctggcgccgttcgtgcaaatgggcagctggatcggcggcgaccgcgacggcaaccccaat
gtcaacgccggcaccatgcagcgcgcgctgacgcggcagtcgaccacgattttcgacttc
tatctggaggaagtgcatgcgctgggcgccgaactgtcggtctcgaccctgatggtcagc
gtcaaccaggaattgctggtgctggcggaaaattcgccggatacatcagatcaccgctcc
gacgaaccctaccgccgcgccctgatcgggatctacgcgcgactggcctcgactgcgcgc
gagctgggcgccaccaacatcctgcgccaggaagtcggcgccgcggcgcactatgcagcg
ccacaggaattcacgcaggaactgcagatcatcgaagactcgctgcgcgcgcatcatggc
agcgccctgatcaagccgcgcctggcgacgctcaagcgcgcctccgagattttcggcttc
catctagcctcgctcgatatgcgccagagttccgacgtccacgaacgggtgctgaccgag
ctgttcgcacaggcgcaggtggaaggcgcctacgacaaactgagcgaagaacagaagatc
gacctgctgctggccgaactggccaagccgcgcctgctgtactcgccgtatatcgagtac
tccgacgaaaccgtttccgagctgtccatcctgcgcgccgccggcgagatgcgccagcgc
tacggcgcgcgctcgatccgcaactacatcatctcgcataccgagaccgtgtcggacctg
ctggaagtcttgctgctgcagcaggaaaccggcttgctgcgtcccgacggcaagaaccac
gccgcaagtacgctggaggtgatggtgattccgctgtttgaaaccattcccgacctgcgc
cgcgcggccgccatcatggaacagttcatggcgctgccgccggtgagccgcctgatcgcc
aagcaaggcaagctgcaggaagtgatgctgggctattccgattccaacaaggatggcggc
ttcctcacctccaactgggagctgtacaaggctgaaatccagctggtgcgtgtgttcgac
cgcgccggcgtcaagctgcgcctgttccatggccgcggcggcactgtcggccgcggcggc
ggccctagctatcaggcgatcctggcgcagccgccgggcaccgtcaacggccagatccgc
ctgacagaacaaggcgaaatcatcgcgtccaagttctccaacccggaaatcggccgccgc
aacctggagctgctggtagcggcgacgctggaagccagcctgatgccgaacaccgccgac
agcaagcagatgaaaaagctgggcgagttcgaagagctgatggacggcttatcggaacgc
gcctaccagtcgtaccgcaacctggtgtatgaaaccccgggcttcaccgactacttcttc
gccgccacgccgattgccgagatcgccgagctgaacatcggctcgcgccctgcttcgcgc
aaatcgacacgccgcatcgaagacctgcgggcgattccatggggcttttcctggggccag
tgccgcttactgctgccgggctggtacggtttcggcagcgccatcgagagctggctggaa
gaaggaaaagacgccaagctgaagagccaaaagctggcgaccctgcgcgcgatgtacaag
gaatggccattcttcgccaccctgctgtcgaacatggacatggtgctgtccaagaccgac
ctggcggtggcctcgcgctacgccgggctggtcaccgaccgcaagctgcgtaacagcatc
ttcaagcgcatcgtcgatgagcatgagcgaaccagcagcatcctgtcggccatcaccggc
gccaaggaccgcctgtccggcaatccattgctggcgcgttcgatcaagaaccgcttcgcc
tatctcgatccgttgaatcacttgcaggtcgagctgatcaagcgccaccgcagcgtgacc
gcggccggccgcacgacggaagaacgggtcaagcgcggcatccacttgagcatcaacggc
attgccgccggcttgcgcaatacgggctga

DBGET integrated database retrieval system