KEGG   Collimonas pratensis: CPter91_5454Help
Entry
CPter91_5454      CDS       T04306                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cpra  Collimonas pratensis
Pathway
cpra00250  Alanine, aspartate and glutamate metabolism
cpra00410  beta-Alanine metabolism
cpra00640  Propanoate metabolism
cpra00650  Butanoate metabolism
cpra01100  Metabolic pathways
cpra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CPter91_5454 (gabT)
   00650 Butanoate metabolism
    CPter91_5454 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPter91_5454 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPter91_5454 (gabT)
Enzymes [BR:cpra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CPter91_5454 (gabT)
Amino acid related enzymes [BR:cpra01007]
 Aminotransferase (transaminase)
  Class III
   CPter91_5454 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMP07737
UniProt: A0A127QCH5
LinkDB All DBs
Position
complement(5636388..5637650)
Genome map
AA seq 420 aa AA seqDB search
MHQRKNAATPRGVGVMCDFYASHALNAEIWDVENRRFIDFAAGIAVLNTGHRHPKLIAAM
QEQLGKFTHTAYQIVPYASYVELAERINAVTPGAHAKKTTFFSTGAEAVENAVKIARVAT
GRSAVIAFSGAFHGRTMMGMALTGKVVPYKVGFGPFPAEVYHVPFPVELHGVSIEQSLGA
LQSLFKADVDPKRVAAIILEPVQGEGGFYAAPPAFMQALRKLCDEHGILLIVDEVQTGFA
RTGKLFAVEHSGVIPDLMTMAKSLAGGMPLSAVCGKAEIMDAAAPGGLGGTYAGNPLAVA
SALAVLEVIEEEQLVERANLLGNKLKQVLEGLRSEIPQIADIRGLGAMVAVEFMQPGTRQ
PDPEFTKKVQAEALKNGLLLLSCGVYSNAIRFLFPLTIEDKLMDEALAILSAAMRTVAAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgcatcaacgcaagaatgccgcaacgccgcgcggggtaggcgtcatgtgcgatttctac
gcttcgcacgcgctcaatgccgagatctgggatgtggaaaatcgccgcttcattgacttc
gccgccggcatcgccgtgctgaacaccggccatcgccatcccaagctgatcgccgccatg
caggaacagctcggcaaattcacccacaccgcctaccagatcgtgccctacgccagctat
gtcgaactggccgagcgtatcaatgcggttacccctggcgcccatgccaagaagaccact
ttcttttccaccggcgccgaagcggtggaaaacgccgtcaaaatcgcccgtgtcgccacc
ggccgcagcgccgtgattgcgttcagcggcgcgttccatggccgcaccatgatgggcatg
gcgctgaccggtaaagtagtgccatacaaggtcggtttcgggccgttcccggccgaggtc
taccacgtgccgtttccggtcgaactgcatggcgtcagcatcgagcagtccctgggagcc
ttgcaatccttgttcaaggccgatgtcgatcccaagcgcgtcgccgccatcatcctcgag
ccggtgcaaggcgagggcggtttctacgccgcgccgccggcgttcatgcaagccttgcgc
aagttgtgcgatgaacatggcatcttgctgatcgttgatgaagtgcaaaccggcttcgcc
cgcaccggcaagttgtttgcggtagagcattccggcgtgatcccggacctgatgacgatg
gccaagagcctggccggcggcatgccgctctcggctgtgtgcggcaaggcggagatcatg
gacgcggcggcgccgggcggcctcggcggcacctacgccggcaatccgctggcggtggcg
tcggcgctggcggtgctggaagtgattgaagaagaacaactggtggaacgcgccaatctg
cttggcaacaagctgaagcaggtgttggaaggtttgcgcagcgagattccgcagattgcc
gatatccgcggcctgggggcgatggtggcggtagagttcatgcaacccggcacgcgccag
ccggatcccgagtttaccaagaaggtacaggccgaagctctcaaaaacggcttgctgttg
ctgagctgcggggtctacagtaatgcgatccgcttcttgtttccgctgaccatagaggat
aagttgatggatgaagcgctagccatcctgagtgcggcgatgcgcaccgtcgcggcagct
taa

DBGET integrated database retrieval system