KEGG   Anaerotignum propionicum: CPRO_09730Help
Entry
CPRO_09730        CDS       T04574                                 

Gene name
yjmD
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YjmD
Organism
cpro  Anaerotignum propionicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox Glu_dehyd_C Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AMJ40571
UniProt: A0A120MK93
LinkDB All DBs
Position
993892..994986
Genome map
AA seq 364 aa AA seqDB search
MSLELKGEWDNDLKCFSPKVLGGLKMKSGIIEKVGVIKIKETPMPKIEKANDVIIKVKYV
GICGSDIHIYHGQNAFAKYPLVWGHEIVGHVHEVGSEVTSVKVGDRVVVEPFIACGKCYS
CKNGRRNACQELKVFGAHIDGGCSEYFKVPESNAHILPDNVSLEDAVLIEPFTIGAQACY
RGQVTKDDFVFVMGGGTIGLTVAENAKILGARVILSDIVDEKLDFAKKHGAEFTINAMKE
NVADRIFEITGGMGANVVIDSICNKKSFEDALTFVSNAGRVVELSFNTTPSEIAPILLSK
GEVSIMGSRHQTNRFPVVIDYVRDEKIVFENFITAFYPLEDMEKAFKYIEQHLDKTRKVV
IKLY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtccttagagcttaagggggagtgggacaacgacttaaaatgtttttctccaaaagtc
ttaggaggtttaaaaatgaaatcaggaattatagaaaaagttggggttattaaaataaaa
gaaacaccgatgcctaaaatagaaaaagccaatgatgtcattattaaggtgaaatacgta
ggcatttgtggctcggatatacatatttaccatgggcaaaatgcctttgctaaatatcct
cttgtttgggggcacgaaattgtgggtcacgttcatgaggttggaagtgaggttaccagt
gtaaaagtgggcgatagagtggtggtagaaccctttatcgcctgtggaaagtgttactct
tgcaaaaacggaagacgaaatgcatgccaagaactaaaggtcttcggagcgcatattgat
ggaggttgttctgaatattttaaggttccggaaagtaacgcccatatactgccggataac
gtatctttagaagatgccgttttaattgaaccctttaccataggggcacaagcttgttat
agaggacaagtgacaaaggacgatttcgttttcgtcatgggtggtggaaccattggtctt
acggtagcggaaaatgctaaaattttaggggctagagtcatattatccgatattgtggat
gaaaaattagattttgcgaaaaagcacggcgctgagtttaccataaacgctatgaaagaa
aatgttgccgatagaatttttgaaattactggtggaatgggagcaaatgtggtcattgat
tctatttgtaacaaaaagagttttgaagatgctttaacttttgtttctaatgccggaaga
gtggtagaattaagctttaatacaacccctagcgagatagcgcccatattgctgtctaaa
ggtgaggtcagcattatgggctcacgtcatcagacaaatcgctttcctgtggtgattgat
tatgtaagagatgaaaaaattgtattcgaaaattttataactgctttttatcccttagag
gatatggaaaaagcttttaagtatattgaacaacatctagataaaactagaaaagtagta
attaaattgtattga

DBGET integrated database retrieval system