KEGG   Anaerotignum propionicum: CPRO_22120Help
Entry
CPRO_22120        CDS       T04574                                 

Gene name
pdhC_2
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpro  Anaerotignum propionicum
Pathway
cpro00010  Glycolysis / Gluconeogenesis
cpro00020  Citrate cycle (TCA cycle)
cpro00620  Pyruvate metabolism
cpro01100  Metabolic pathways
cpro01110  Biosynthesis of secondary metabolites
cpro01120  Microbial metabolism in diverse environments
cpro01130  Biosynthesis of antibiotics
cpro01200  Carbon metabolism
Module
cpro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPRO_22120 (pdhC_2)
   00020 Citrate cycle (TCA cycle)
    CPRO_22120 (pdhC_2)
   00620 Pyruvate metabolism
    CPRO_22120 (pdhC_2)
Enzymes [BR:cpro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CPRO_22120 (pdhC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 DUF3867
Motif
Other DBs
NCBI-ProteinID: AMJ41792
UniProt: A0A0X8VA25
LinkDB All DBs
Position
complement(2310236..2311564)
Genome map
AA seq 442 aa AA seqDB search
MAQEVLLPKLGLTMTEGTIDEWKFKEGEFVKKGDILYSVSTDKLTNDVEADAEGVLLKIL
VPAGETTACKAVVAYLGEAGETIAETSAQTEKTEEKPQEQTGKGTTQSSAAPIREGVLAS
PAAKKLAKEKNIEIGLIVGTGPNGRITLQDVEAYLANPQPENTAEKTKTSPMAAKLAEEL
GVNIQSISADGRVMKKDVLAAANVEAAVAPVSNNDQQPVKVNALRRSIAANMTLSWQTSP
RVTYTHPVDTTAMKEMRDKLKVACKDDNVKLTFNHIIIKMTAKVLMEFPDVNASFADNML
TRHTHANVGLAVAKGDGLIVPNVKGVDTKSLIEVAKETEALIEAARSGKIAMEDMTGGTF
TISNLGPYGITNFSPIINQPELAILGVCDMVETPVVRNGQIEIRPMMNLCLTADHRVVDG
VMAAKFLKRLCDLLENPYLLFT
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggaagttttattacccaaattgggactgaccatgacagaaggaaccatcgat
gaatggaaattcaaagagggtgagtttgtaaaaaaaggagacattttatatagtgtttct
acagataaattaaccaatgatgtggaagcagacgcagaaggtgtgcttttgaagatttta
gtacctgctggggaaaccacggcgtgtaaagctgtggtagcctatcttggcgaagcggga
gaaaccattgcagagacgtctgctcagacagaaaaaacagaagaaaaaccccaagaacaa
acggggaaaggaacaacacaatcctctgccgcaccgattcgagagggagttttggcttct
cctgcggcaaaaaaattagcaaaagaaaaaaatattgaaattggtttgatagtgggaaca
ggccccaatggtcgtattaccctgcaggatgtggaagcttatcttgctaatccacagccg
gaaaatactgcagaaaaaacaaaaaccagtcctatggcggccaaactggctgaggaattg
ggtgtgaatattcaatcaatttctgctgacggcagagtgatgaaaaaagacgttttggcg
gcggcaaatgtagaagcagcagtggctccggtgagcaataatgaccagcaaccggtgaaa
gtaaatgctttgcgtcgaagcattgccgcaaatatgacattgtcttggcaaacctctccc
cgtgtgacttatacccaccctgtggatacaacagcaatgaaagaaatgcgggataaatta
aaagttgcctgcaaagatgacaatgtgaagctaacctttaaccatattattatcaaaatg
acagcaaaggtgctaatggaattcccagatgtaaatgcaagctttgcagataatatgctc
acaagacatacccatgccaatgtgggcttggcggtggcaaaaggcgatggactgattgta
cccaatgtgaaaggggtagacacaaaatctttaattgaagttgccaaggaaacagaggct
ttgattgaagctgcccgtagtggaaaaattgctatggaagatatgacagggggcaccttt
actatttctaatttaggcccttatggcataaccaatttttcacccatcatcaatcagcct
gagctagcaattttgggtgtttgcgatatggtggaaacacctgtggtacgaaacggacaa
attgaaatccgcccaatgatgaacctatgcttaacggcagatcatcgggtggtagacggg
gttatggcggcgaaattcttaaaacgtctttgcgaccttttggaaaacccatatcttttg
tttacataa

DBGET integrated database retrieval system