KEGG   Candidatus Cyclonatronum proteinivorum: CYPRO_0214Help
Entry
CYPRO_0214        CDS       T05709                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cprv  Candidatus Cyclonatronum proteinivorum
Pathway
cprv00620  Pyruvate metabolism
cprv00680  Methane metabolism
cprv01100  Metabolic pathways
cprv01120  Microbial metabolism in diverse environments
cprv01200  Carbon metabolism
Module
cprv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cprv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYPRO_0214
  09102 Energy metabolism
   00680 Methane metabolism
    CYPRO_0214
Enzymes [BR:cprv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CYPRO_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXI99501
UniProt: A0A345UGA0
LinkDB All DBs
Position
complement(287079..289898)
Genome map
AA seq 939 aa AA seqDB search
MRTTRKGIQVNAEGEGISTSLSRQVNLLGSLIGEAVRDQAGKEMFDIVDGLRSKCKTAYI
DNNPALREDTRQTINGLALERIDWLLRAYTAFFHMVNKAEQQEIIRINRQRELKADAGKT
RAESISQAVAMLKASGLTYEQVVEVLQKMDIQPTLTAHPTEARRRSVLRIQNRISKALGR
LGSRTLTPAEEEQEIDEMYRQIKLLLNTDDVRSTRLTVYDEIKNGLFFFTNAIWKTIPLI
YRDMRQALLTHYGKAPEMSVFIRYRSWIGGDRDGNPFVTPEVSRFTLQAHRNAVVELYLE
ALKELRSELSISTRQISVPEKLLDAVAADRKVVTLSEEVESVHKYEPYRIRISQIMAKLQ
MSFPPDDKGLLRPTKATDEAFVYTFDAFLGDLEFIRECLREQHFPELAENGSIATLIMQV
RTFGLSLASLDVRQHSSVFEHTINELFAQAGVTANYARLGEEERIALLSEELKNPRPLVP
FSTQLSDKTQDTIDIFHTIRKTTRVDPQAIGSIIISMTHQVSDMLEVLILAKECGLWQLE
GNKVNSRIDVVPLFETVEDLENSDKLMARLYENPVYRLHLEARNRFQEIMLGYSDSNKDG
GYWMANWSLHLAQEKLARVCRNYDIDFRLFHGRGGSVGRGGGRANQGMLALPPVCHSGRI
RFTEQGEVISFRYAHTHVAHRHIEQIVNATLRATASGLGYHKESVEPENGGFSAIMDEIA
DTSMKAYHGLIHHEDFWPWYTQVTPIEHISRLPIASRPVSRKTGSEVDFGSLRAIPWVFA
WTQIRHNIPGWFGVGTALHHQTETEGRLEKLQQMYREWPFFKVVLDNAQREMARANFAIA
PYYTGLSEISTIPEMIQKEFSLARTAILQITGQQELLDNNPVIQKSIRLRNPYTDVLNLV
QAELMTRWRAKDDSDEGKQLRYLLFTSINGVAAAMQSTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagaactacccggaaaggcatacaagtaaacgccgaaggcgaaggcatttcaacctca
ctcagcaggcaggttaacctgctcggctccttaatcggggaggccgttcgtgatcaggcc
ggcaaagagatgtttgatattgtggacgggctgcgaagcaaatgcaaaacggcctacatc
gataataatccggcgctccgcgaagatacgcggcagaccatcaacggtcttgcgcttgag
cgcatcgactggctgctgcgggcctacaccgcttttttccacatggtaaacaaggcggag
cagcaagaaatcatccgcattaaccggcagcgcgaattaaaggctgatgccggcaaaacc
cgggcggaatctatttcgcaggctgttgctatgctgaaagcatccggactcacgtatgag
caggtcgtcgaagtgcttcagaaaatggacattcagccgaccctcacggcgcacccgacc
gaggcccgccgccgttcggtgctgcgcatccaaaaccggatctcgaaagcgctcgggcgg
ctcggttcgcgcacccttactcccgcagaagaagagcaggaaatcgacgagatgtaccgg
cagatcaagctgctgctcaacaccgacgatgtgagaagcacgcggctcaccgtctatgat
gaaatcaaaaacggactcttctttttcaccaacgccatctggaagaccatcccgctgatt
taccgcgatatgcggcaggccctgctcacgcactacggcaaagcacccgaaatgtcggtc
ttcatccgctaccgctcctggatcggcggcgaccgcgacggcaatccgttcgtgaccccc
gaagtaagccgcttcaccctgcaggcgcaccgcaatgccgtcgttgagctttacctcgaa
gcgctcaaagagctccgcagcgaactcagcatttcaacccggcagatttcggtacctgaa
aagctgctcgatgctgttgcggctgaccgtaaagtagtaaccctgagtgaagaagtggaa
agcgttcacaaatacgagccgtaccgcatccgcatcagtcagattatggccaaactgcag
atgagtttcccgcctgacgacaaagggctgcttcgcccaacgaaggcgactgacgaagct
ttcgtgtacactttcgatgcctttttgggagatttggagtttatccgggaatgtctgcgg
gaacagcattttccggagctggccgagaacggctccatcgcaacgctcatcatgcaggta
cgcaccttcgggctctcgctggcttcgcttgatgtgcggcagcacagctcggttttcgag
cacaccatcaacgagcttttcgcgcaggcgggcgtcacggccaattacgcgcgactcggt
gaggaagagcgcattgccctgctcagcgaggagctgaaaaatccgcgtccgctggtacct
ttcagcactcagctcagcgacaaaacacaggacaccatcgacatcttccacaccatccgc
aaaacgacgcgggtcgatccgcaggccatcggcagtatcatcatcagcatgacgcatcag
gtgagcgatatgcttgaagtgctgattctggctaaagagtgtggactttggcagctcgaa
ggcaacaaggtgaacagccgcattgatgttgtgccgctttttgaaacggtggaagacctc
gagaacagtgacaaacttatggcacggctgtacgaaaatccggtttaccggctgcatctg
gaagcccgtaaccgttttcaggaaatcatgctgggctacagcgacagcaacaaagacggg
ggctactggatggccaactggtcactgcacctcgcgcaggaaaagctggcacgggtgtgc
cgtaattatgacatcgacttccgccttttccacggccggggcggttcggtagggcgcggg
ggcggacgcgccaatcagggcatgctggcactgccaccagtttgtcacagcgggcgcatt
cgcttcaccgaacagggtgaagtgatctctttccgctatgcgcatacgcatgttgcgcac
cggcacattgaacagatcgttaacgctacgcttcgggctacggcttccgggctgggttac
cacaaggaatcggtcgagcccgaaaacggcggcttttcagccatcatggatgaaattgcc
gatacttcgatgaaggcctatcatggtctgattcatcatgaagatttctggccgtggtac
acgcaggtgacccccatcgagcatatttcacgcctgccaattgcttcacgtcctgtttcc
cgtaaaaccggcagcgaagtagatttcggcagtctcagggccattccctgggtttttgca
tggacccaaatccggcacaacatccccggctggttcggggtcggaacagcgctgcatcat
cagacagagaccgaaggaaggctcgaaaagctgcagcaaatgtaccgcgagtggcccttc
ttcaaggtagtgctcgataatgcgcagcgcgaaatggcccgggccaatttcgccattgcc
ccgtattacaccggcctgagcgaaatcagcacgattccggaaatgattcagaaggaattc
agtcttgcgagaacagccattctgcaaatcaccggtcagcaagaactgctggataacaac
ccggttattcagaaatccatccgcctgcggaacccttataccgatgtcctgaaccttgtt
caggccgagctgatgacgcgttggcgtgccaaggatgattctgatgaaggcaaacaactc
cgatacttgctgtttacgagcataaacggggttgctgccgctatgcagagcacgggttag

DBGET integrated database retrieval system