KEGG   Candidatus Cyclonatronum proteinivorum: CYPRO_2112Help
Entry
CYPRO_2112        CDS       T05709                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cprv  Candidatus Cyclonatronum proteinivorum
Pathway
cprv00970  Aminoacyl-tRNA biosynthesis
cprv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cprv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CYPRO_2112
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cprv03029]
    CYPRO_2112
Enzymes [BR:cprv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CYPRO_2112
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CYPRO_2112
Mitochondrial biogenesis [BR:cprv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CYPRO_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY AbiJ_NTD3
Motif
Other DBs
NCBI-ProteinID: AXJ01361
UniProt: A0A345ULK9
LinkDB All DBs
Position
complement(2739749..2741206)
Genome map
AA seq 485 aa AA seqDB search
MTATLPQDTEFETVIGLEVHAQLLTQSKAFAPVKAGFGSEPNTNISPLCLGHPGTLPVLN
ENLVRFIVKMGLATSCTIAPKSIFARKNYFYPDLPKGYQISQYENPICQNGWIEIEDEAG
NTRKIGITRIHMEEDAGKSIHDQDPHNTLVDLNRAGTPLMEIVSEPEIYSPAEAWAYLTQ
IRQIVRYLGICDGNMEEGSLRCDANVSIRPKGQRAFGTRTEIKNLNSFRNVERAIAYEVE
RQKQLVLSGGEVVQQTLLWDPNRMETRQLRSKEEAHDYRYFPDPDLPPVVVSDAMREEIR
AELPELPRQKSQRFMQEMELPAYDARLLTEERAFADFFEAVCEAGAKPKLAANLLLSEVK
RVLNEQNLDIAAFPVDAARLAGLLQLRADNKINSSALQTIFNEMLSKSGDAEEIAKTLNL
IQVSDNSFLEPVVDEVIRKNPEEAERYRAGAKKLMGFFVGAVMKQTKGKANPQLVTQLVR
EKLGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaactctcccgcaggataccgaatttgaaaccgtaatcggacttgaagttcac
gcacagctgctgacgcaaagcaaggcttttgcccccgtaaaggcaggttttggcagcgaa
cctaacaccaatatttctccgctttgtctcggtcatcccggtacgctgccggtactgaat
gagaacctggtgcggtttatcgtgaaaatgggtctggcaaccagctgtaccattgccccg
aagtccatttttgcccgtaaaaattatttttatccggatcttcccaagggctatcagatt
tcgcagtacgagaatccgatttgtcagaacggctggattgagatcgaggatgaagccgga
aacacccgcaaaatcggcattacgcgcattcacatggaagaagatgcgggcaaatccatt
cacgatcaggacccgcataatacgctcgttgacctcaaccgtgccggtacgcccttgatg
gaaattgtgtcggagcctgagatttactccccggctgaagcctgggcgtatctgacgcaa
atccggcagattgtgcgctatttgggtatatgcgacggaaatatggaagaaggaagtctg
cggtgcgatgcgaacgtgtcgattcgacccaaaggtcagcgggcgttcggaacccgaacc
gaaatcaagaacctgaactcgttccggaatgtggagcgcgccattgcgtatgaggtcgaa
aggcagaaacagctggttctgagcgggggggaagtggtgcagcaaacccttctgtgggat
cccaaccgcatggaaacgcgtcagctgcgttctaaggaagaagcgcacgattaccgctat
tttccggatccggatctgccgccggtggttgtgagcgacgcgatgcgggaagaaatccgc
gctgaattgcccgagcttccgcggcagaaaagtcagcgcttcatgcaggaaatggagctc
ccggcttacgatgcgcgattgctgactgaagagcgcgcgtttgccgatttttttgaagcg
gtttgtgaagccggtgcgaaacccaagcttgcggccaaccttttgctttcggaagtgaaa
cgggtactcaatgagcaaaatcttgatattgccgctttcccggtagatgctgcacgtctc
gcaggtttgcttcagcttcgtgcagacaataaaatcaattcatccgccttgcagaccatc
ttcaatgaaatgctcagtaagtccggtgatgcggaagagattgcgaaaacgcttaatctg
attcaggtttcggataacagctttctggagccggtagtagatgaagtcatccgcaaaaac
cccgaagaagcggagcgctaccgtgctggggcaaagaagcttatgggcttttttgtcggt
gcggtgatgaagcaaaccaaaggcaaagccaacccgcagctggttacacaattggtaaga
gaaaagctcggagcgtga

DBGET integrated database retrieval system