KEGG   Candidatus Cyclonatronum proteinivorum: CYPRO_3036Help
Entry
CYPRO_3036        CDS       T05709                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cprv  Candidatus Cyclonatronum proteinivorum
Pathway
cprv00564  Glycerophospholipid metabolism
cprv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cprv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CYPRO_3036
Enzymes [BR:cprv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CYPRO_3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA HI0933_like Pyr_redox_3 NAD_binding_8 Pyr_redox_2 Lycopene_cycl Thi4
Motif
Other DBs
NCBI-ProteinID: AXJ02273
UniProt: A0A345UP71
LinkDB All DBs
Position
complement(3913910..3915457)
Genome map
AA seq 515 aa AA seqDB search
MLKEIRDYSGFWDVIIIGGGATGLGAAVESASRGYKTLLLEKYDYSKGTSSRSTKLVHGG
VRYLQQGNVSLVLEALRERGLMIQNAPHLCRNQSFIVPNYDWWGGPFYGVGMKVYDMLAG
KLGLGPSKILSRDETVKRIPTIEAEGLRGGVIYYDGQFDDSRLAVNLAQTAVEQGASVIN
YMNVTGLLKSKDGFTSGVKVTDTLNNDDYELNAHVVINATGVFTDSIVKMDDPEAKPMVQ
PSQGIHIILDKEFLPGDSAIMVPQTDDGRVLFAVPWHDKVVVGTTDTAVDTIDYEPRAFD
EEIEFVMTHAARYLNKDPEMKDVRSVFAGLRPLVKPQDAKGTSAISRDHTLLVSESGLVT
ITGGKWTTYRKMGQDTINQAALVAGLESRECVTENMRIHGWVKHQDISDPLHLYGSDAPG
VRKLYAETPDLENKLHKDLPYIKAEIVWAARHEMAMTIEDVMSRRTRAILLNAKASIEAA
PEVARLLAAELGHDEAWQKAQVDAYTKLAEGYTLG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagaaatccgcgattattccggtttctgggatgttatcatcattggtggtggt
gcaaccggactcggtgccgcggtagaatcggcttcaaggggatataaaaccctgctgctt
gaaaaatatgattactccaagggtacgtccagccgctcaaccaaactggttcacggcggg
gttcgatacctgcagcagggtaacgtaagcctcgtattagaagcgttgcgcgaacgcgga
cttatgattcaaaacgcaccccatttgtgcagaaatcagtcttttatcgtaccaaactac
gattggtggggcggccccttttatggcgtgggtatgaaagtgtatgatatgctcgccgga
aaactgggcctgggaccttccaaaattctttcccgtgacgaaactgtcaaacgcatccca
accattgaagctgaaggcttacggggcggggtaatttattatgacgggcagtttgacgac
tcccgccttgctgtaaaccttgcccaaacagctgtagaacaaggggcaagcgtaataaac
tacatgaatgttaccggccttctcaaatccaaagacggcttcacaagcggcgtaaaagta
accgatacgctgaacaatgatgattatgagctgaatgcgcatgttgtgattaatgccacc
ggtgtatttactgattccatcgtcaagatggacgatcccgaagctaaaccgatggttcag
ccgagtcagggaatccacatcattttagataaagagtttttgccaggcgattctgccatt
atggtgcctcaaactgacgacgggcgcgtgctcttcgcggtgccatggcacgataaggta
gtagttggaaccactgatactgctgtagataccattgattatgagccacgtgctttcgac
gaagagatcgaattcgtaatgacgcacgctgcccgttacctgaataaagatcctgaaatg
aaggatgttcgcagcgtatttgcaggtctgcgtccgcttgttaagccacaggacgccaaa
ggtacttctgccatttcgagagatcataccctgcttgtttctgagtcgggactggtaacc
atcaccggtgggaaatggactacctacagaaagatggggcaggatacgatcaatcaggct
gctttggtagccggacttgaaagccgtgagtgtgttaccgaaaacatgcgtatccacgga
tgggtgaagcatcaggatatcagcgacccgctgcatctttatggttcggacgcacccggc
gttcgcaagctgtatgctgagacgcctgatctcgaaaacaagctccacaaagatttgccg
tacatcaaagccgagatcgtatgggccgcacgccacgaaatggcaatgacgatagaagat
gtaatgtcaagaagaaccagagctatacttctgaacgcgaaagcaagtattgaagccgct
ccggaagtagcacgtctgttggctgcagaacttggacatgatgaggcctggcaaaaagcg
caggtggatgcctataccaaacttgcagaggggtatacactcggctga

DBGET integrated database retrieval system