KEGG   Colwellia psychrerythraea: CPS_1007Help
Entry
CPS_1007          CDS       T00258                                 

Definition
(RefSeq) putative decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00250  Alanine, aspartate and glutamate metabolism
cps00410  beta-Alanine metabolism
cps00430  Taurine and hypotaurine metabolism
cps00650  Butanoate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps02024  Quorum sensing
Module
cps_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CPS_1007
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPS_1007
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPS_1007
   00430 Taurine and hypotaurine metabolism
    CPS_1007
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CPS_1007
Enzymes [BR:cps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CPS_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ25150
UniProt: Q487K9
LinkDB All DBs
Position
1027156..1028787
Genome map
AA seq 543 aa AA seqDB search
MKATKRIAEATQESLHRIFTIAEAPDSTLGRLEQEMSQNLVGFLNNHIVASKNALTDIEQ
DFINARIPEQPEFVSDHMHHLLDKLVAQSVHTSSPSFIGHMTSALPSFILPLSKLMVGLN
QNLVKVETSKAFTPLERQVLGMMHNLVYQHDDVFYKNWMHSAEHSLGAFCSGGTVANITA
LWVARNKLLKADGDFRGVAREGLHRAMRHYGYQDLAILVSDRGHYSLKKSADILGIGQEN
VIAIPTDEHNKIDCQKLADKCQQLAAQNIKVLAIVGVAGTTETGNIDPLDKIAEIAQQNQ
CHFHVDAAWGGATLLSNKYRPLLKGIEQADSVTIDAHKQMYVPMGAGLVIFKDPASVSAI
EHHAEYILRKGSKDLGSHTLEGSRPGMAMLVYSSLHIISRPGYEMLINQAIEKAEYFADI
IHQHDDFELITRPELCLLTYRYAPKSVQALLARNDDEANKSVNMLLGKLTKFIQKRQRED
GRSFVSRTRIEVSRYGGEKVIVFRVVLANPLTTKEILQGILQEQCQLAQESEQFLPELLQ
AAK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactaagcgcattgcagaagcaacgcaagagtctttacatcgaatttttacc
attgctgaagctcctgattctaccttaggacgtcttgagcaagagatgtcgcaaaattta
gtgggttttttaaataatcacattgttgctagcaaaaatgccctaactgatattgagcaa
gatttcattaatgctcgtattcccgagcagcctgaatttgtttctgatcacatgcaccat
ttgctcgataaattagtcgcgcagtcagtacatacttcaagtcctagttttatcggtcat
atgacctcagcattgccttcttttattttacctctgtctaagttgatggtgggtttaaat
caaaacttagttaaagttgaaacatcaaaagcttttacgccattagagcgccaagtttta
ggcatgatgcacaacttggtttatcaacacgatgatgtcttttacaaaaactggatgcac
agtgctgaacattcccttggcgccttttgttcaggtggtactgtcgctaatattaccgcc
ttgtgggtagcacgtaataagctgttaaaggctgatggtgattttaggggcgtggctcgc
gagggcttacatcgtgctatgaggcattatggctatcaagacttagctattttagtgtcc
gatcgtggtcattactcattgaaaaaatcggctgatattttaggtatcggccaagaaaat
gttattgcgatacctaccgatgaacataataaaatagattgccagaagctggcggataaa
tgtcagcaactggcagcacaaaatatcaaagtactggcaattgttggcgtggccggtaca
actgaaaccggtaatattgatccacttgataaaattgctgagatagcccagcaaaatcaa
tgtcattttcatgttgatgctgcttggggcggagcaacattattgtcgaacaaatatcgt
cctttgcttaaaggcatcgaacaagctgactcagtgaccattgacgcacacaaacagatg
tatgtgcctatgggggcaggtttggttatttttaaagatcctgcctcggtaagtgcgatt
gagcatcatgcggaatatatattacgtaaaggctcaaaagatttaggtagtcatacttta
gaaggctctcgcccgggaatggcgatgttagtgtattcgagcttgcatattattagccga
ccaggttatgaaatgcttattaatcaggccattgaaaaagcagagtattttgcagatatt
attcaccagcatgatgattttgaactaattactcgccctgaattgtgtctattaacgtat
cgctatgcacctaagtcagttcaggctctattagctcgaaatgatgatgaagctaataag
tcggtgaacatgttgctcggtaaattgaccaagtttattcaaaagcgtcaacgtgaagat
gggcgctcttttgtctcacgaactcgcattgaagtaagtcgatatggtggtgaaaaagtt
atcgtttttagagttgtgttagcaaacccactaactactaaagaaattttgcaaggtata
ttgcaggagcaatgtcagcttgcacaggaaagtgagcaatttttacctgagttgttacaa
gcagcaaaataa

DBGET integrated database retrieval system