KEGG   Colwellia psychrerythraea: CPS_2217Help
Entry
CPS_2217          CDS       T00258                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00020  Citrate cycle (TCA cycle)
cps00190  Oxidative phosphorylation
cps00650  Butanoate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
Module
cps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPS_2217 (sdhA)
   00650 Butanoate metabolism
    CPS_2217 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CPS_2217 (sdhA)
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CPS_2217 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CPS_2217 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AAZ25640
UniProt: Q482S5
LinkDB All DBs
Position
2316824..2318590
Genome map
AA seq 588 aa AA seqDB search
MSVPIREFDAIVIGAGGAGMRAALAISESGKSCALISKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDYIGDQDAIEYMCKTGPESIIELEKMGLPFSRTEEGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKNKTNVYSEWYALDLVKNSDGAVVGT
TAICIETGEIVYFKARATVLATGGAGRIFASTTNAHINTGDGVGMSLRAGIQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCDGPWGPHIKLKLDHLGRETLYKRLPGVCDLSKTFAHVDPAEEPIPVIPTCHYQMGGV
PCNVNGQALNIGSDGKETIVEGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGNFLG
TYLNETQTATEASESDLEAALARTNRWESSTKGEDPVQIRKDLQMCMQMNFSVFREGEAM
AQGMKELTEIRERLSDARLDDKSSEFNTQRIECLELDNLMETAFCSAKAANFRTESRGAH
ARQDFTERDDVNWLCHSVYTPETEEMTKRDVNMKPVHREAFPPKARVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttccaattcgtgaatttgacgccattgttattggcgcaggcggtgcaggtatg
cgcgctgcattagcaatttcagaatcaggcaaatcttgtgccttgatttctaaagtattt
ccaactcgatctcatactgtatcggctcaaggtggtattaccgtagctttaggtaatgcc
catgaagatcactgggaacaacacatgtacgataccgttaaaggtagcgattatatcggt
gaccaagacgccatcgaatatatgtgtaaaacaggcccagagtctattatagaattagag
aaaatgggtttaccgttttctcgtacggaagaaggtaaaatttaccaacgtccatttggt
ggccagtctaaaaactttggtggcgaacaagccgctcgtactgctgccgcagctgaccgt
acaggtcatgcactacttcattgtttatatcaacaaaacgttaaaaacaaaacgaatgtt
tactcagaatggtatgcattagatttggttaaaaacagtgatggtgctgtcgttggtaca
actgctatttgcattgaaactggcgaaattgtttactttaaagcacgtgctactgtactt
gctactggtggtgctggtcgtatatttgcttctacaaccaatgctcacatcaacaccggt
gatggtgttggtatgtctcttcgtgctggcattcaaatgcaagacatggaaatgtggcaa
ttccatccaaccggtatagctggtgcgggtgtacttgttactgaaggttgtcgtggagaa
ggtggttaccttctgaataaagacggcgaacgcttcatggaacgttatgcaccaaatgct
aaagatttagcagggcgtgatgttgttgctcgttcaatgatgacagagattcgtgaaggt
cgtggttgtgacggtccttggggtccacatattaagttgaagcttgatcatctaggccgt
gaaacgttatataaacgtttacctggtgtttgtgatttatctaaaacttttgctcatgtt
gatccagcagaagagcctattccagttatacctacatgtcactaccaaatgggtggtgta
ccttgtaatgttaatggtcaagcccttaatattggcagtgatggcaaagaaactatcgtt
gaaggtttattcgctgttggtgaaatcgcttgtgtatctgtacatggtgcaaaccgctta
ggcggtaactcactacttgatttagtagtatttggtcgtgcagcaggtaacttcttaggt
acttacttaaacgaaacacaaactgcaacagaagcatctgaatctgatctagaagcagcg
cttgcacgtactaatcgttgggaatcttctactaaaggtgaagaccctgtacaaatccgt
aaagatttacagatgtgtatgcaaatgaacttctcagtattccgtgaaggcgaagccatg
gcgcaaggcatgaaagagctaactgaaatacgtgaacgtttaagtgatgctcgtttagat
gataagtcatcagaattcaacacccaacgtattgagtgtttagaattagataacttaatg
gaaacagctttttgttctgcaaaagcagcaaacttccgaacagaatctcgtggtgctcat
gcacgtcaagatttcactgaacgtgatgacgtaaattggttatgtcactcagtctacaca
ccagagactgaagaaatgaccaaacgtgatgttaatatgaaacccgttcaccgcgaagct
ttccctccgaaagcacgtgtatattaa

DBGET integrated database retrieval system