KEGG   Colwellia psychrerythraea: CPS_2218Help
Entry
CPS_2218          CDS       T00258                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00020  Citrate cycle (TCA cycle)
cps00190  Oxidative phosphorylation
cps00650  Butanoate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
Module
cps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPS_2218 (sdhB)
   00650 Butanoate metabolism
    CPS_2218 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CPS_2218 (sdhB)
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CPS_2218 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CPS_2218 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AAZ24901
UniProt: Q482S4
LinkDB All DBs
Position
2318602..2319309
Genome map
AA seq 235 aa AA seqDB search
MKQLFSIYRYNPDVDNAPYMKDYELEVPEGSDLMVLDALILLKETDSSLSFRRSCREGVC
GSDGLNMNGKNGLACITPLSELKADKIILRPLPGLPVVRDLIIDMTQFYQQYEKIKPYLI
NDAQPAARENIQTIEERDKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFLI
DSRDTATEERLDGLQDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLNRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagttattttcgatttaccgttacaaccctgatgttgataatgcgccatacatg
aaagactatgagttagaagttccagaaggttctgacttaatggtacttgacgctctgatt
cttttaaaagaaacagattcaagcttatctttccgtcgctcgtgtcgtgaaggtgtttgt
ggctctgatggcttgaacatgaatggtaaaaatggcttagcttgtattacgcctttatca
gaattgaaagccgataagatcattttacgtccattaccaggtttaccggtagtacgtgat
ttaattattgatatgactcaattttatcagcaatatgaaaaaattaagccatacctaatt
aatgatgcacaaccagcagcgcgtgaaaacatacagacgattgaagaacgtgataaatta
gacggcctttacgaatgtattttatgtgcatgttgttcaacatcatgtccatctttttgg
tggaatcctgataagttcatcggcccagcaggtttattacatgcgtatcgattcttaatc
gatagccgtgatactgcaaccgaagaacgtttagatggtttacaagatgcctacagcgta
tttcgttgtcatggcatcatgaactgtgttgatgtttgtccaaaaggactaaacccaaca
aaagcgattggtcatatcaaatcaatgttattaaaccgagcggtttaa

DBGET integrated database retrieval system