KEGG   Colwellia psychrerythraea: CPS_4716Help
Entry
CPS_4716          CDS       T00258                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cps  Colwellia psychrerythraea
Brite
KEGG Orthology (KO) [BR:cps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CPS_4716 (ahpF)
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CPS_4716 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored NAD_binding_8 FAD_binding_3 FMO-like Thi4 K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AAZ28071
UniProt: Q47V12
LinkDB All DBs
Position
complement(4991903..4993474)
Genome map
AA seq 523 aa AA seqDB search
MLDTNLQTQLKSYLDNLKTPVELITFTDESPKAKELAQLVTQIAELSPLITEINGNNSEQ
AANERVPSMLVRSVASNSEMRFAGLPMGHEFTSLVMALLHSGSHPLKIEAEQIEQVRNLE
GDFVFETYISLSCQNCPDVVQALNMMAAINPNIKHTMIDGSLFQTEVFDRDVMAVPSVYL
NGESFSQGRVSLTDILNKVDTNAGARQAKALENKDTYDFLVVGGGPAGAAAAIYAARKGI
NTGLVADRFGGQVSDTMAIENFISVKATQGPKLVASLEEHVREYDVDIMNSNKASKVKRN
EATGLVEVSLENGAVLKSKSVVLATGARWREMNVPGENQYRGKGVAYCPHCDGPLFKGKP
VAVIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADDILVRKANSLTNVTIITNAQTTEV
HGDGTRVTSLSYTDRGTGEHHSLALAGIFVQIGLMPNTEFLQGEIELTNRGEIIAGSRGE
TSITGVFAAGDVTNNPYKQIIIAMGSGANAALGAFDYLIRQDV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagacacaaacttacaaacacaattaaaaagttatttagacaacttaaaaacacca
gtcgagctaatcacctttactgatgaaagccctaaggcaaaagaacttgctcaattagtg
acacaaatcgctgaattatcaccattaatcactgaaattaatggtaataatagtgaacaa
gcggccaacgaacgcgtgccatctatgttagtccgtagtgtggcgagtaatagcgaaatg
cgttttgcaggtttaccaatggggcacgaatttacctcattagtcatggcgttattacac
agtggttcacaccctttaaaaattgaagctgagcaaatagaacaagtacgcaacctcgaa
ggggattttgtttttgagacctacatctcgttaagctgtcagaattgtccggatgtagta
caagccttaaatatgatggcagccattaacccgaatataaaacacaccatgattgacggt
tcgttatttcaaacggaagtgtttgatcgtgatgtgatggcagtccccagtgtgtattta
aatggtgagtcatttagtcagggtcgtgtgtcattaaccgatattttaaataaagtagat
accaatgcgggtgctcgccaagctaaagcattagagaataaagatacctatgacttttta
gttgtcggtggtgggcctgcaggtgccgccgccgcaatttatgcggcacgaaaaggtatt
aatactggcttagttgcagaccgatttggcggacaggtcagtgataccatggcgattgaa
aactttatctcggtcaaagccacacaagggccaaaacttgttgctagtttagaagaacat
gttcgtgaatatgatgtagatatcatgaacagtaataaagcgagtaaagtgaagcgcaat
gaagctacaggactggttgaagttagcttagaaaatggcgccgtattaaaaagtaagtcg
gtggtattagcaactggcgcacgctggagagaaatgaatgtaccgggtgaaaatcagtat
cgcggcaaaggggttgcttactgtcctcattgtgacggaccactctttaaaggcaaaccc
gtagcggttattggtggtggtaattcaggtattgaagctgccattgatttagccggtatt
gtagagcatgtcactgttttagaatttgcagacacgctacgtgcagatgatattttggtg
agaaaagctaattcattaactaacgtcactattattactaatgcgcaaaccactgaagtg
catggtgatggtacacgtgtcactagcttaagttacaccgaccgaggtacaggtgaacat
cattcactggcattggcaggtatttttgtgcaaataggcttgatgccaaacactgagttt
ttacaaggtgaaatagaattaactaatcgcggtgaaattattgcaggtagccgaggtgag
acgtctattacaggggtttttgcagcaggcgatgtaaccaacaacccttataaacaaatt
attattgcgatgggaagtggtgcaaatgctgctttgggagcttttgattaccttattcgt
caagacgtttaa

DBGET integrated database retrieval system