KEGG   Chlamydia psittaci 01DC12: BN356_0411Help
Entry
BN356_0411        CDS       T02343                                 

Definition
(GenBank) putative serine/threonine-protein kinase
Organism
cpsd  Chlamydia psittaci 01DC12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo Kinase-like Haspin_kinase SpoIIE Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: CCO01566
LinkDB All DBs
Position
47978..49486
Genome map
AA seq 502 aa AA seqDB search
MDCQSEILPLNQAIGAYHIKKILSKKEGSAVYQGLHSETLQSAAIKVLEPPLVADTRRVH
NFLKEARIIEQVSHPHIVKLYQYGQCREGLYIAMEYIQGVSLRQYILTHLIPLSKAIDIV
LHIGQAIEYLHSRGILHRDIKPENILINSQGQIKLIDFGLAVCSSTEHASHPACLGTPSY
MSPEQRQGDKVSEKSEIYSLGLIAYELISGNLALGKVILSLIPDRVSKILAKALQPSPKD
RYGSMKEFMSHLHRYRYSQDLQKDYRNKDYTAQVNEQLYQQRFWLSPTEIVVPDFLSVSI
YEQGYPTHPHVYYEAYMSQDTFRLWFCYSLSGNATLVLTIIKTFVSQWGHEDNIRSTMRK
MHSELMRINVPIDTTEISLVCVTIPKEKKELSWITCGKTSFWLKKQGKVPQNFTTSSLGL
GKISSLQIQETKVAWEIGDGAVLHTLPADDSMSSLNSPLFTELKDRGQTAIFCPIESVQF
GILENHDGNLCPSTLISLKRIR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcaatccgaaatacttcctctgaatcaggcaataggtgcttaccacatcaag
aaaatcctgagtaagaaagaaggaagcgcggtgtaccagggtttgcattctgaaactcta
caatctgcagctattaaagtgcttgaaccgcctttagttgctgatacgcgcagagttcat
aactttttaaaagaagcacgaattattgaacaagtctcacatccccatattgttaagtta
tatcaatatggacagtgtagagaaggtctgtatatagccatggaatatatacaaggcgtg
tctcttagacagtatatcctcacccatctaattcctttatccaaggctattgatatagtg
ttacatattggccaggctatagaatatctgcatagccgtggtatactccatagggatatc
aaacccgaaaatatcctgattaattctcaagggcaaatcaaactcatagattttggactt
gctgtttgttcttctacagaacatgcttctcatcctgcttgtttaggaacgccttcatat
atgagccctgaacaacgtcaaggagataaagtttctgaaaaatcagaaatctactctcta
ggtttaattgcttatgaattgatctcgggaaacctagctctaggtaaggtcattttatca
ttgattccggatagagtgagtaagattttagcgaaggccttgcaaccttctcctaaagat
cgttacggatctatgaaagaattcatgagtcatttacatcgatatcggtacagccaagac
cttcagaaagattatcgtaataaagattatacagcacaggttaatgagcagctgtatcag
cagagattttggttatctcctacagaaattgttgtccccgacttcttatccgtttctata
tatgagcaaggatacccaacacatcctcatgtatactacgaagcttatatgagtcaggat
actttccggttgtggttttgttatagtctttcaggaaatgcaactttagtattaactatt
ataaaaaccttcgtaagtcagtggggccatgaagataacattagaagtacgatgcgaaaa
atgcatagtgagctaatgcggatcaatgttcctattgatacaacggaaatttctttagtt
tgcgttactattcccaaagaaaaaaaggaactttcttggattacttgtgggaaaactagt
ttctggttaaaaaaacaaggaaaggttcctcagaattttactacttcatccttaggttta
gggaaaattagttctttacaaattcaggaaaccaaggttgcatgggaaataggtgatgga
gcagtattacataccttaccggcagacgattccatgtcatctttaaatagtcctttattc
acagagttgaaagatagaggacaaacagctatattctgcccaatagagagcgtacagttc
gggatattagaaaatcatgacggaaatctttgtccctcaacacttatcagcttaaaaaga
atccggtga

DBGET integrated database retrieval system