KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_00557Help
Entry
CPTA_00557        CDS       T03482                                 

Definition
(GenBank) Serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Brite
KEGG Orthology (KO) [BR:cpse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpse01001]
    CPTA_00557
Enzymes [BR:cpse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CPTA_00557
Protein kinases [BR:cpse01001]
 Serine/threonine kinases: Other
  Bacterial family
   CPTA_00557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AIG06386
UniProt: A0A1L6CXF2
LinkDB All DBs
Position
complement(585565..587085)
Genome map
AA seq 506 aa AA seqDB search
MSIDYASPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQREVAVKVLRPEFSDNNE
FLSRFRNEALASENIISENVVQTFDYRELTDPSGRTLCFIVMEYVRGESLADMLARKGTL
DEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGKVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGRRPFTGDSSVSVAIAHINQA
PPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSTTRMGQRPPQPQSAQLQQIAP
EPTPTASTHALGQTAQPTTVIPATGEVPQTVSVGQMTGTHTGYSAAPATIPPEEKKKSSG
GVGTGLAVGVLLAALFGAGVWAASQGIFGDLLGGSDQPSSSVNPETITATVTETPTIREE
PRPIQRPQVTPTISSEPSEFPDASESVVPLPPTDNPRTAPTVDLNERSQVPSTHQNTSPT
PTRGNGSDPIADLLNTLNTPEQGGAP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgattacgcttctccagatcccgcgcttcaggccctcatcggcgacgactat
cgtctccagtgggttgtgggtaccggcggcatgtctacagtatggcttgccgacgacacc
cgtaaccaacgcgaggtagcagtcaaggtcctgcgtcctgagttttctgataacaatgag
ttcctctccaggttccgcaacgaggcgctcgccagcgagaacatcatctcagaaaacgtt
gtacaaacttttgattatcgcgaactcaccgacccatctggccggacattgtgcttcatt
gtcatggaatatgtgcgtggtgagtctctcgcagacatgttggcgcgtaaaggaaccctc
gatgaggatcttgccctcgatgtcctcgagcaggcggcccatggcctatccattattcac
aggatgggcatggttcaccgcgatattaagcccggaaacctcctgattacccaaaacggc
aaagtaaaaatcaccgattttggtatagccaaggcggcggccgctgtcccgttgactcgc
accggcatggtagtgggaactgcacaatacgtctcaccggagcaagctcagggtaaagat
gtcactgaagcatcagacgtctattcccttggcgttgtggggtatgagatgctcgccggc
agacgtcctttcacaggtgattcctctgtctcggtagctatcgcccatatcaaccaggca
ccacccgctcttcccactacggtttccgccccagcccgtgagcttatcggtatcgcctta
cgtaaggatccagcgcatcgatatgccgacggcaatgagcttgccctggcagtgtctact
acccgtatggggcagcgtcccccgcagcctcagtcagcacagctccagcagatagcaccc
gaaccaacccctactgcttcaacccacgcattaggtcagacggcacaacccaccacggtt
atcccagccactggagaggttccgcagactgtttctgttggtcagatgacgggaactcat
actggttatagcgcagctcccgcaacaattccgccggaggaaaagaaaaagagctctggc
ggagtaggcactggtctcgctgtgggagttctcctcgcagcattatttggtgccggcgta
tgggctgccagccaaggtatctttggcgatttgttgggaggaagtgaccagcccagtagt
tcggtcaatcccgagacgattaccgcaacggtcacggaaacgcctacgattcgggaagaa
ccacggccaatccagcgtccacaggtaactcctacgattagcagtgaaccttcggaattt
cctgatgcctcagaatctgttgttccgctgccgcccacggacaatccccgaacagcgccg
accgtagatctcaacgagaggtcgcaagttccttccactcatcagaatacgtctcccact
ccaacacgcggaaacggttctgaccccatcgccgatctattgaacactcttaatacccca
gaacaaggaggtgccccatga

DBGET integrated database retrieval system