KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_00870Help
Entry
CPTA_00870        CDS       T03482                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Brite
Translation factors [BR:cpse03012]
 Eukaryotic Type
  Elongation factors
   CPTA_00870
 Prokaryotic Type
   CPTA_00870
Mitochondrial biogenesis [BR:cpse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CPTA_00870
Exosome [BR:cpse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CPTA_00870
  Exosomal proteins of breast cancer cells
   CPTA_00870
  Exosomal proteins of colorectal cancer cells
   CPTA_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIG06699
UniProt: A0A1L6CZ34
LinkDB All DBs
Position
914129..915319
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggtaccatcggtcac
gtcgaccacggcaagaccaccactaccgctgctatcaccaaggttctggctgacgcatac
ccggatctcaacgaggctttcgccttcgacgccattgacaaggcaccggaggagaaagag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtggatgctccgggtcacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgtggttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggttggcgttccttacatccttgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gctgagcaggattacgatgaagaggctcctatcatccacatctccgctctgaaggctctt
gagggcgacgaggagtggaccaagtccatcctcgagctcatgcaggcttgcgatgattcc
atcccggatccagagcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggccgtgttgagcgtggccagctgaacgtc
aacgaggacgttgagatcatcggtatcaaggaaaagtccacccagaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctcctc
ctccgtggtatcaagcgcgaagacgttgagcgcggtcaggttgttgttaagccaggcgct
tacactcctcacaccgagttcgagggctctgtctacgtcctttccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system