KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_00623Help
Entry
CPTC_00623        CDS       T03484                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
cpsf00500  Starch and sucrose metabolism
cpsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPTC_00623
Enzymes [BR:cpsf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CPTC_00623
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CPTC_00623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AIG10911
LinkDB All DBs
Position
631227..632825
Genome map
AA seq 532 aa AA seqDB search
MFNPRNGLPVPPAWLETAIFYEIYPQSFYDSNGDGIGDIQGIVDKLDYIADLGANALWIN
PCFDSPFKDVGYDVRDYYTVAPRYGTNADLEKLFTEAHNRGIKVLLDLVPGHTSEQNDWF
QYSCKAEPNQYSDRYIWTSHAFDNGDGLPFIGGEAPRNGTYILNFFKSQPALNYGFNKKT
RPWQQSVDAPGPVANQEEMANIMRYWLDKGADGFRVDMADSLVKFDGEDKQETIKVWQKI
FARFRNDYPEAAFVSEWGKPIQALKAGFDMDFYLDWRNNGYNILARNTDDPLGRSEDLSF
FKQVSGTSPQEFIDQYWPQYEQIRDLGYFSLISCNHDTPRLAPRLNDAERRLFFMFLLTM
PGVPFIYYGDEIGMRYLDIPTKEGGYQRTGTRTPMQWDAAKKNYGFSSAQTEELYLPQDT
AADAPDAASQMLDPAALRPFIQKLIGLRSQHPELHADSDFSFLWAHDNSRILAYRRESSD
GKRCAVALNAGDTADSITLESPATIIVSSGDARVEDNTVHLGPSSGVVVELA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaccctcgaaacggacttcccgttcctcctgcatggcttgaaacggcgatcttt
tatgagatctatccgcaaagtttctacgattctaacggtgatggaatcggcgacatacag
gggatcgtcgacaagcttgattacatagccgaccttggcgcaaacgcgttatggatcaac
ccttgcttcgattccccctttaaggacgtaggatacgacgtccgcgattactacacagtg
gcaccgcgctacggcactaatgctgacctagaaaagctattcacggaagcccacaacaga
gggatcaaagttctactcgaccttgtccccggacacaccagtgagcagaacgactggttc
cagtattcctgtaaagcagaacccaaccagtattcggatcgctacatctggacatctcac
gcctttgataacggcgacggccttcccttcatcggaggcgaggcaccccgcaatggcacc
tatatcctcaattttttcaagagccaaccggcactcaactatggctttaacaagaaaaca
cgcccctggcagcaaagcgttgatgcccctggtccggtagctaaccaagaagagatggcc
aacatcatgcgctactggttggacaaaggcgcggacggtttccgagtagacatggccgat
tccttggtcaaatttgatggtgaagataaacaagaaaccatcaaggtgtggcagaaaatc
tttgcgagattccgcaatgactaccctgaggcggcatttgtctcagaatggggcaagcct
attcaggcgcttaaggccggctttgacatggacttttacctagattggcgcaacaacggc
tataacatcttggcccgcaacacagacgatccgctagggcgcagcgaagacctcagcttt
ttcaagcaggtgtccggaacctcgccacaggagttcatcgaccaatactggccgcaatat
gagcagatccgcgatcttgggtacttcagcctaatctcttgcaatcatgacaccccgcgt
cttgcgcctcggctcaacgatgccgagcgccgcctgttcttcatgtttctactcaccatg
cccggcgtcccattcatctactatggcgatgaaattggcatgcgctacctcgatatccca
actaaagagggcggataccaacgcactggtacccgcacgccaatgcagtgggatgcggcg
aagaaaaactacgggttctccagcgcacaaacagaggagctatatcttccacaagacaca
gccgctgatgccccggatgcggcctcgcaaatgctggatcccgcggcgttacgccccttc
atacaaaagctcatcgggctgcggtcgcaacatccagagctgcacgcagacagcgacttc
tcattcctgtgggcacacgataactcccgaatcctcgcttatcgcagagaatcctcagac
ggaaagcgctgtgcagtagcccttaatgccggcgacaccgcagatagcatcactctagag
tccccggcgaccatcatcgtgagctccggcgacgcccgagtggaggacaacaccgtgcac
ttggggccgtcatcgggagtagtggtggaattagcttaa

DBGET integrated database retrieval system