KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_01775Help
Entry
CPTC_01775        CDS       T03484                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
cpsf00010  Glycolysis / Gluconeogenesis
cpsf00520  Amino sugar and nucleotide sugar metabolism
cpsf01100  Metabolic pathways
cpsf01110  Biosynthesis of secondary metabolites
cpsf01120  Microbial metabolism in diverse environments
cpsf01130  Biosynthesis of antibiotics
cpsf01200  Carbon metabolism
Module
cpsf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPTC_01775
   00520 Amino sugar and nucleotide sugar metabolism
    CPTC_01775
Enzymes [BR:cpsf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CPTC_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AIG12063
LinkDB All DBs
Position
1856852..1857604
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRIVAEAEWEG
PVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAAGIAEVAFG
EDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAAKDRDELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggcggatctgggattaaaggtgcccgcgtt
gatctggataccggtgattttgtcggagatcggatcaaaattttaacccccaagcctgcc
acccccgaagcggtcgcccaaacgatttctcgcattgttgcagaggccgaatgggaagga
cccgtcggaataacgctgccttccgtaatccggaatcaagtagcactttctgccgccaac
attgaccaatcatggatcaatgttgatgttcaaaaattatttaccaagaccctgggcggg
cgtaacatcgcagtgcttaacgacgccgatgcggcgggcatcgccgaggtagccttcgga
gaagatcaagctcgacgtggttccgccattttgctcactctaggcactgggatcggttcc
gctttctttatcaacggggtcttattccccaacaccgagttagggcacatgatcgtagag
ggaaaggaagccgagcatctagcttcatctgcagcaaaagatcgcgatgagttgagctat
tccaaatgggccaagcgcgtttctaaagtcctcagcgaatacgaacgacttttttggcca
gacgtttttatcgtaggcggtggtatctcacgcaaagctgataaatgggtacccaaactc
actatcgatacgcccgtcatacctgcaaaactacgtaataccgcaggtatcgtaggagca
gcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system